Values

Education

Service

apply


f@0 }D$s E D$E$6xD$t E D$E$xtKD$t E D$E$WxD$D$t $D$E$U=
News
ELF`u44 (44444477X77HHH Ptd>ȾȾTTQtd/lib/ld-linux.so.2GNU  (A!@ @`)aR D! QTD#A*&pL9:#A DE5$ PB@R9NH:@cDUA" : A"jD@,(P)T@r>(?@ABCDFGHIJLNOPQRSUWZ]_`cdfghijklmnoqsvwxz}   !"$'(*,/12345689<?ADEHIJKLMORUYZ^_`acdeghjklqrsuwxz{|   !#$'+,-.0123578;<?ABGIJML[ tNcRĭc]@=vXň;LA OGt埭k|@4Y> p^5ĭswYe?(疘vonӨG vޛ2 tY*p+p؂|| ^%HDj|Csu*gv˘7LCoDl Ieqgʹ{*09zJ#b:(.w|QMYF0rB8a7wFCbч{_Զ y&I#')7'2QTȁ'/-9zy@<SnQ+k"q펣2qmIC7ڣ75R_M jms5­=Erts:ϤIStKI yTXA#՛v7FUCE/ AڞY;d/`7XhI#!yX:h:7\p䞼.XxbZBcċjY~K?̳F؟Z}S>[f`>4{sMѫ}|܇#]_[jA9'#[!P8::Hju٠ѯx1?mHWWoƿ9oF $mNq فCa%QWd &*K D?=~J 3n$s-j<_BHws  Q B : G(j#D[?oX 2e,_l&8?JTz[H Xd`ؚTF-_C8Gas=CyW\Te"!>G^ڲk,^ 7OAm>u,MU-"#[#YS1FfUacһg>Z5OWoN>P[Wlr1fQ,?>ܠWo/ !Z_j3hDNnOVp]Lf[H R )ʭQ| 1"'s=aGq9]1lvA3q͠9rf*d? 㗅5fBfTΐn-k-D_#5H|᳨ʊQz(HjrZ3G|-k2 gG^k,$$._IoƗJ?&77ԋ Gyq;(;zV_jpUP׮|2ke "fbߚᲴMexGzV__>-=0`OZd2?b?zYL %Xi_Q,* K|Q} pK|K|Q-js |mqXѺʤ[7DřPmj M×4L% 8C=5MuI,ƔwSqzF,9 Ħ^ToF,AGV; e@dcob#Bȫ=j=.Fb$SǷ@ 1FVŐW.{I elkJR=pxR!EXL|xm L| MeP&P7S7gcI߂G8ECJ9~)=үur\. %Ulj#y9|MJ9e<8dž"rQ-s-\ ;{?F9@@} ~ ꒼{S%5D!͡15dǏwtX^BB%!C9Ta&K"2lUZ`!7!85-{?aL'@A ZR> c*PD՝J!YD2b픚u GGHƽo/Cͣix)KU72d&`j4r_mR?~|s[g4*g?7j#mlvFM?5: W73I;ջ{JfIR@U2PKÛ@{$by~ϒE4ũxD?}5qo_j2Řtw+s ;/!8m-f}PBꤋTg*y﷭`KqɤT6CuS όDV;I_ 0|t;ڦEN ч3yl[ n$?{-{#NŐXi1CmT$y>ܫ NɝTv6.x9+Ш_ase[Xׯ! cn #mnG\q[G8MO]|hyOi/=5 ac{oIpղK֠sd([ "fg#K}IY) Vd`~-܎8MG_s)%4M+S\a[ӦoTtPRJ9LW @UNBw#[8VLδcx`3 [ mmQrE,0A2+{#̡ 쪰"HCC!I;]$}߼Sy|s 3y):E>y E d=ʹ2L6ǥ 3~(Ve@qșY$;_ 0=eDZs  zwIfBHhJҎԓ 』~eAڙ׸}e`ڂ+Oe縞ĻIm}-%[kU7m髍rpd NHK s{-&[| Ue!(Yy }2 \XA+D>NȷǑLwP"E%eM@"g#qJ GwL9}B%U,k C"Or1-K# 6,@e5uʦt"v3 bTB܊j?zW8`, =t"F+i"#P(QfcZh}{+=*!΄+έ,\ߏ&z=ܪX5c]]QBN,M]%HrE[sNnJ>\Y\\vIQW!>M#\V4I#4*4(`3v>20612k<hL@ 6  j[Rn7ID5 0'@"gSr}L&z"7^qtCg2EsA~^ ?zoW==X6DATS;=<UDZ<71;%20}t2~$1'mW2O39-4XS"| *99+baL#Nu"o_H)${FP Q&| dC3 D#D;h?z_X-7ED <AJ5(h4$G2 Y8'&1 *<76d-"7|%o=',# 4R'DЙ F S|;<#<0i IN l+Qp W .@)7"&a'@  V[ %   vPa -Sl4vh  = l$  zA`uD` l[L`A`P@[; u q ]9` X 50U + aJS :_44?\0X{t8t488$I^- v v\ F g1& Q0 F "Hs .B\ 7,G Z 0  5} 8EB#0X?. J 2+0?v 62+8 vXfP  Q<  Z p  /3N 4H=&  W F@2`! 19@ g @  tA *@ # :\ @I  T% lb*<)$ AφO LQ<86 O U 0 f<L #@  /3 L p $} yP7F*!  t 8V; Y^o +/P  E$+1-@ , ? I;|N&P q  FAX@o  ?,[-' 9 j /rl8  MMl@o L 89 - WF@[ C( HTi %`$lCP P? 3  KPP?  8})5 'X`  ~- R^H ]60 -Zj 8@.Q H#S LA  5LDo %lmnY  2 ? LR  .6$,  k)D  =`gGB2 4 l~9l A@>2 S '@: D%^[  d:gX<~ ll `l8@vT@i{ U`IliF>r iN   2 Z R$X l%)@Yl60] & V|lAm  0# #:!A\  KPX / k@  8?U y$  L;Q p  YW,B m-l CV O`>R CW`N d JX6_ ]I<&`;  ) O*H  S; W % 8&?f?} fZI   2).` M B` E(  M; < B( uF,1l;%WF . O1 EN K$ 4`SU`ql~V^ 9 s$51 : 6`L W@  %p  M4X   GŸV _  V"l+`G  ; ;`<0 IZ. *H ,R  @ a 9T0 UW  -fV E&_5(S `  qZ4 'R C  J   C3`?:k  +P l0u T. +t k3,D &w o Y<U2L @,%>R 5 w $8H@@C@ OTX`+EO GLP z I Z `lE`%lK'(Tz9" u%`J I # 0x   T 47 A3` Z Fp v.Z>P0r !@?hC~ 0J #غ d<tQ5 ?D + 7  H\ a>) t HG l?U\x;P5?s F\?\Q/pI > `@@8 fa D?oK{ Gz  j4p;=) Q`  o  ]a K:( sN mU`!l(K >)@1  .:L 8 p  + X 8?;ˢA H& %`U  W: Y@4p W`!@ 6- ' =.P  .!l4G K U`  1@  I; %v MRwSHmH?v o7=OW JT : 'BW n T(E& 9}./# " Ed''  r UBP ZKf %&J  =o U kHl(0 jY_ . WD4~ \#?&0  N7@ZP } NAD G   6 ?  8=`c Z  =iU ' w w8 > ;+ ? / ^5/` -#0 ,7 Y>J!486O 3 Q' 3<WN F`!l a#n   G>WlF U?E .  O5I {;`BT y u Pw   a2Ȅ[ *8\AGD  v</& K@ V!0 # V U L l(S Qy  9?B@h"pk M*pG J@7 JWl`s,> 2 %pW  4*`IC:3O v(_1B6?'0YlHCW   #@y h  # T,?> PY77>pu Y@x  A B <b M A l"S o[ {R [@~ , ' &QK@ :Gb ? #yQ .<X/;R@  Di WOx K   E.0&  )G # CF`2 I + 0 Q ) H`  "N'_$`-J QJ   '[23,`/OY@n y H=:   u6d?l4`?:6&H0 W 9q 5< &M  3o 6 uW  7Xew (K G4 wG t< 3JY  o & 6lF~  %p  : WC T| + 3   6Gŝ 0C: *C  * M-   j24g Q `@R`p)I  X@  EQ PP  B SL  :(#A )X : /`TD/^ . {5?8Lp| D ,0 Q >* IМ 9 TUx8@ + J Y  CO D   `l  d c'8 H   F@ H 5T + 0   yY U!7 68 AD" y Y  lPU |LК  e"_ $( u uG 3E C 6p  t@o c !> ?9 N BE,'8p0]l! B@  /R 5Y"Ll&P  ,2 @GK [^Q: N` *P O Y[  62wl6=K @r<Vb 0$< VG -@ U 1QR  U[ @Y8\Z@T  _Q[ C0X (*  \y?l 1Aw _E <J"@1(kM #.X! \Sp  }2` % uCm*j>B'!Z N+ -K 1T;d7 <P S jM_ = 9   B 0@ > Y %':2Q 2,0  BK G K ]&$?    9Љ 6 T`P@:SV \  W Q8y+z  O{u 3 i GL mV>P( l)E c =9 W @ 4G~E S ,%E"0  "` ' &<Ѐ  *J + q  i]S4 8 RN ~(9 lI@j>`Dj,  D7rp H@  5R: G Q  HБM iQ a\ O`  O`r#3J .' `Sl!C 7  ? S/ f;  !l\ E$N\;O7D *@kTV`H<( Ts>35  3L@97b a"\P 1 Vt;<[  [ @E  Z 3 2 . 42 s H9U4l <&4  - 4?9.rHЍ  (<WVo (8e 5,e?c:l?=&`=%!GL?x-z4 :  'Fx Zl h . f/ 7@;I9@=PB Y l& 2 q $`  8`&"b  U(1IH N?Y@p 0 ;0 @ 'NI 8 4U|?|[ (<}*D<' iR@D  `  B hWPR  Xp  a`) -5cm lY!,z QP?7`  t>; Am6 l& JS?  R l2rl5@ Ep + AH [<i  D N $  '2 g {";- "N@<?  "P  Y  7 ! WMD /\$m ;` >D   C 7 > SV [T [% I GI (  (fl>@l8%!X o"t  lJ`<`Hh5z  t  * < 0@ p C+ jB@flkO * *@9u!K8`[   8p  ?ELd )p  $7@3Zk. 7 ] h  :p?4  K Q |  !p  2`8{  Wlp  xMm M3utw %\  O @  8,@  L  q:#;   S(3 k9@9#;} l^L * U,5'),@5>6/ KS % P`  U Z ' ! eZ`Z X W  8 6J@ w 2KlNZ% V)h  +&h':6 C` S*  B ?+ 8?CJaRp " "&$m^ 6C 8Nn   P o 81p8 4   $l$ x v  -? L * WH0   G6uj \X   VD`1  D`C , ` . n  l B 5|l9 + \4 H' P `. i T ` SU S<>   R=%F[@ x O2 N V ,n  ^HH $~ 3`  KH  Qr. ?-<1S,A@C  fL7& 5#l Fp  :M~o`@ d1л  Q7 VZ}H iM Tl[`` q P N@[@ S B D B[ hAHlKnDa0T  T lxmu 2@Jg?Ou _l@qSn  [7 ԭ  v/ 5KڈE O0@ b B2m pt M  *b  A   pX ) &)kM6 E @_ c @XlnIy"`ShR05 F c ; EOh?@Z -l@lDyR 3O`#6;  D?@ Ї %|]+^=9?9@9A9B9C9D9E9F9G9H9I9J9K9L9M9N9O9P9Q9R:S:T:U :V:W:X:Y:Z :[$:\(:],:^0:_4:`8:a<:b@:cD:dH:eL:fP:gT:hX:i\:j`:kd:lh:ml:np:ot:px:q|:r:s:t:u:v:w:x:y:z:{:|:}:~::::::::::::::::::::;;; ;;;;; ;$;(;,;0;4;8;<;@;D;H;L;P;T;U T 58%8%8h%8h%8h%8h%8h %8h(%8h0%8h8p%8h@`%8hHP%8hP@%8hX0%8h` %8hh%8hp%8hx%8h%8h%9h%9h%9h% 9h%9h%9hp%9h`%9hP% 9h@%$9h0%(9h %,9h%09h%49h%89h%<9h%@9h%D9h%H9h %L9h(%P9h0%T9h8p%X9h@`%\9hHP%`9hP@%d9hX0%h9h` %l9hh%p9hp%t9hx%x9h%|9h%9h%9h%9h%9h%9h%9hp%9h`%9hP%9h@%9h0%9h %9h%9h%9h%9h%9h%9h%9h%9h %9h(%9h0%9h8p%9h@`%9hHP%9hP@%9hX0%9h` %9hh%9hp%9hx%9h%9h%:h%:h%:h% :h%:h%:hp%:h`%:hP% :h@%$:h0%(:h %,:h%0:h%4:h%8:h%<:h%@:h%D:h%H:h %L:h(%P:h0%T:h8p%X:h@`%\:hHP%`:hP@%d:hX0%h:h` %l:hh%p:hp%t:hx%x:h%|:h%:h%:h%:h%:h%:h%:hp%:h`%:hP%:h@%:h0%:h %:h%:h%:h%:h%:h%:h%:h%:h %:h(%:h0%:h8p%:h@`%:hHP%:hP@%:hX0%:h` %:hh%:hp%:hx%:h%:h%;h%;h%;h% ;h%;h%;hp%;h`%;hP% ;h@%$;h0%(;h %,;h%0;h%4;h%8;h%<;h%@;h%D;h%H;h %L;h(%P;h0%T;h8p1^PTRh h QVh4vUS[tX[ÐUS=08u?7-7X,89v&,87,89w08[]Ít&'U7tt $7ÐL$qUWVQ\ED$$$,A?88tJJD$$uS88t"JJD$T$$ (88t$D$$ JJJD$$(y9$eD$D$ $$88t $( EEDŽ E}~卅J¸D$D$$1DžJJPJD$ JD$D$$?D$$g (D$$u $ tD$ $uj$ NE$1E$ 4$ (ED$$ thD$$ Pt D$D$$@ StD$$ 0$ D$E$茯U$M[D$ E D$E$nD$$D$D$ ED$E D$E$豣88t D$D$$` eD$ E D$E$NnD$ $Ku"D$D$$ pD$ E D$E$mD$ $u"D$D$$  D$D$$L UW4EUD$ o ED$E D$$mD$$( )UD$4 E D$$3mD$A $0D$G $ED$t U T$$ltxUD$t E D$$lUPD$ T$D$U $UD$D$ ED$E D$$赭$ED$o U T$$ku $ ED$ U T$$ktEUT$U T$$p/ED$E D$E$UED$E D$$ UD$ ' ED$E D$$))UED$E D$$2mUED$E D$$_UD$ E D$$ktsUD$ E D$$IkD$$UD$D$ ED$E D$$t$ $UD$o E D$$jD$D$$YEЃD$ $ЃD$ $9tRЃD$ $t $ |D$D$' $ tݍD$D$' $ ft݋UPD$ T$D$U $D$ $ZuEEmEh_EЍHEh_EL$D$$uEEEl_;E}uEl_t Ep_t-UD$D$ ED$E D$$赩.D$D$ $$4_]UD$'! E D$E$gD$'! E D$E$gD$D$$xED$D$ ED$E D$E$D$ ' ED$E D$E$$$$US4EED$E D$$*ED$E D$E$\ED$E D$E$/Y‹E$ 88tE$ D$$NUPD$ T$D$U $tED$D$ ED$E D$$,ED$! E D$$hMtpED$! E D$$MUPD$ T$D$U $ߴED$D$ ED$E D$$藎EED$E D$$NEED$E D$$ED$ ' ED$E D$$r EED$E D$$AU(EEE $֡‹E$ Eǀ, D$H% E D$E$*Lu $X% !D$H% E D$E$aLUPD$ T$D$U $藳D$D$ ED$E D$E$wD$"" $tE}u $% ~88tE$ D$$% 轸EE $,‹E E t!E tE u $& ~E $t"E D$D$U& E$ҸEE$ ;E[E$USDD$Y& E D$E$JD$ $ۻD$f& E D$E$KJu $t& B}D$& E D$E$JUPD$ T$D$U $踱88tD$$& 9UPD$ T$E D$E$0$D$& E D$E$ItcD$& E D$E$ID$f& E D$E$IUP\$D$ T$D$X# $MD$f& E D$E$jI‹MPD$T$ L$D$<# $蔰88tD$$& D$"" $E}u $,' {EPED$T$ ED$E D$E$蓆E$rD[]U8EEED$E D$E$ ED$E D$E$EED$d' E D$E$Gu $t' zD$d' E D$E$HUPD$ T$D$U $SUPD$ T$E D$E$/tmp@D$' E D$E$BGtAD$' E D$E$GUPD$ T$D$U $軮88tD$$' D$( E D$E$AtnD$( E D$E$AUPD$ T$D$U $D$D$ ED$E D$E$ɂr$( UXEEED$E D$E$oEED$E D$$$fD$ D$( E D$E$~W88tD$$( ӭ88tED$E D$$otED$) E D$$4@ED$) E D$$q@‹ET$E D$ $?tlED$ ED$E D$$W E}t>ED$7) E D$$ @D$ T$E D$E$pVED$M) E D$$?D$ $ȰuEED$E D$$)EED$E D$$"E $EU88tEUD$T$$d) BEUD$T$ D$) $~D$ D$) E D$E$UEED$E D$$z@EED$E D$$ED$ ' ED$E D$$EED$E D$$2ED$" E D$$ >twED$" E D$$M>D$$ED$D$ ED$E D$$v$$ED$# E D$$u=tuED$# E D$$=UPD$ T$D$U $ED$D$ ED$E D$$~ED$) E D$$<trED$) E D$$!=UPD$ T$D$U $WED$D$ ED$E D$$~3ED$' D$D$  ED$E D$$IUWSp EEE4 E@ED$ U T$$;ED$ U T$$;uU4 йЃNo S@ELEC@T st@ atem@ent @or S@ELEC@T_FI@ LE f@$ound@(.UED$E D$$$UED$E D$$UED$E D$$ UD$) E D$$:UD$) E D$$;$.uZU4 йЃ
  • @Inva@lid @ sess@ion @ID. @ED$) U T$$<:t0ED$) U T$$:tUE D$$zED$) U T$$9UD$) E D$$-:D$$`EEH]EEUD$E D$$9‹E D$\$$I{uEE9E|}t"D$  D$) E D$E$P}uvU4 йЃ
  • @The @date@ you@ sup@plie@d is@ not@ val@$id. @(}U4 йЃ
  • @One @or m@ ore @of t@he d@ates@ you@ sup@$plie@(d is@, not@0 val@4id. @8ED$ * U T$$7UD$ * E D$$ 8D$$SEԡ88tD$$* EEEԋUD$E D$$\7tkU4 йЃ
  • @Only@ hum@ ans @may @use @this@ for@ m. E9E]ED$[* U T$$6UD$[* E D$$6UD$E D$$6D$$责$`D$$辧tkU4 йЃ
  • @Only@ hum@ ans @may @use @this@ for@ m. ED$ U T$$5#UD$ E D$$6D$$9Eء88tD$$l* ͢ED$* U T$$U5t1UD$* E D$$5D$$EE0EE؋UD$E D$$4U4 йЃ
  • @Plea@se s@ uppl@y a @valu@e fo@r UD$* E D$$g4t"EE܋U4 D$$ѣ EE؋U4 D$$诣E4 D$* $藣88tE4 D$$* FE9EED$+ U T$$3t>UD$+ E D$$3$suE4 D$ + $ED$>+ U T$$_3UD$>+ E D$$3D$$EE8EEUD$E D$$]3$uEE9E|}tE4 D$ + $JED$N+ U T$$2UD$W+ E D$$2D$ $ޣu^UD$g+ E D$$2ËUD$N+ E D$$2\$$蘣tE4 D$t+ $蜡E4 _88tE4 D$$+ 8EPUPD$$TEء88t"EPD$T$$+ ܞEuEE؋UPD$ T$D$, $88tD$$$, 肞EE؋t$E9E|ED$7, U T$$0tgUD$7, E D$$1D$$UD$D$ ED$E D$$Iv$ED$H, U T$$V0tgUD$H, E D$$0D$$dUD$D$ ED$E D$$u$PED$Y, U T$$/u3ED$h, U T$$/uE4 $bUD$Y, E D$$/UPD$ T$D$U $UD$h, E D$$?/tAUD$h, E D$$/UPD$ T$D$U $踖E@ t7UD$D$ ED$E D$$gp$FET$U T$$誽p [_]U(EEED$E D$E$3ED$E D$E$EED$) E D$E$-.D$) E D$E$l.D$E D$E$-tpD$ ED$E D$E$XE}tED$E D$E$!ED$E D$E$N"D$$$gƅ~ED$E$x~t?U8_ET$D$ L$D$- $(0ED$ T$D$- $}tE4#D$, $訐EU4#D$$艐EE;EE4#D$- $at!9t$- S_EDE+EEԋE䋄T$$ޑt EE;E|͋E;Eu $ . SSt5EE؋D$E D$E$ D$$M3EEԋD$E D$E$M D$$$fEEԋD$ T$D$- $[U4#D$$;E~E4#D$;. $E9E88tE4#D$$D. 膌U4#E T$D$ ED$E D$E$FN‹EP E@ D$e. E D$E$E $ftU4 D$D$$荈D$e. E D$E$UPD$ T$D$U $ D$D$ ED$E D$E$_D$r. E D$E$E $sU4 D$D$$̇D$r. E D$E$UPD$ T$D$U $KD$D$ ED$E D$E$_1D$' D$D$  ED$E D$E$*$豎`[_]US4 EED$E D$E$=UE D$T$$sE]E$肢EtEס88t\ED$$. ߉E8E􋄅PLE􋄅T$ D$ED$$. 袉EE;E|EU4#D$D$. $уE&E􋄅D$$. Yu3$ܓD$D$. $wE􋄅D$ D$$. u:$聓ƅD$D$. $0E􋄅D$E$xE􋄅D$E D$E$nD$D$$ƅ$xE8_D$ D$D$. $pE􋄅D$E D$E$D$D$$o$f'D$D$$膈D$- $谉E4#T$$薉E;E~E4#D$, $sEE;EE4#D$/ $K88tE4#D$$/ U4#E T$D$ ED$E D$E$H‹EP E@ D$+/ E D$E$9t"D$+/ E D$E$|$xE $nU4 D$D$$E4 D$ ED$E D$E$]D$EE؋EET$$?u`E؋E܉D$ T$D$'1 $^y}t-E؋E܉D$ T$D$/1 $+yE9EfE؋D$$. 謂u%D$D$. $xE؋D$ D$$. uDD$$~ƅD$D$. $lxD$E D$E$D$D$$qz$f'D$D$$~D$- $E4#T$$E;E~E4#D$, $uEE;EE4#D$/ $M88tE4#D$$/ |U4#E T$D$ ED$E D$E$>‹EP E@ D$+/ E D$E$;t"D$+/ E D$E$~$zD$E $Ze‹E E $`‹E$ E$ D$D$>2 $rD$ D$A2 E D$E$!E $zED$P2 E D$$ ED$V2 E D$$ ED$V2 E D$$ $wEED$P2 E D$$ $wE}uXED$P2 E D$$j ‹ED$T$ ED$E D$ $O$NwE}'}ED$ ED$D$]2 $SqD$$k2 vU4#D$$xED$P2 E D$$ $vE}uXED$P2 E D$$w ‹ED$T$ ED$E D$ $N$[vE}t8ED$D$~2 $upU4#D$$*xED$2 E D$$D$ 2 D$2 E D$E$@EEE$ ;E} E$ EED$D$>2 $oD$ D$2 E D$E$88tE4#D$$2 2uE$U4#E ET$L$ ED$E D$$6‹EP E@ ED$e. E D$$bE $]U4 D$D$$*qED$e. E D$$qUPD$ T$D$U $nED$D$ ED$E D$$_HE $c\$9$#xE@ tE $4\$y9E ${`‹E E $[‹E$ E $[‹E( 88t&E( E$ T$D$$t MsE$ $[]UEEE47E4#D$2 $sE}tsEU47D$$rE47D$2 $sE}uE47D$2 $gsE}tEE47$USTEEEEEE $dZ‹E$ Eǀ, ED$V2 E D$$tDED$V2 E D$$$ rE܃}~E, U܋E, 88tE$ D$$3 qEO88tEԉD$$03 qE $w‹E E^E EtB]؋U؋E݄4GݝE E$Sq܅Eݜ4GEE( ;EE, PE, }OED$ E D$$XtEED$E D$$舔EE$ ED$_3 E D$$tuED$_3 E D$$EUPD$ T$D$U ${jED$D$ ED$E D$$3DfED$! E D$$o=ED$H# E D$$KED$d E D$$'48uz48ED$d E D$$QD$$u >oED$H# E D$$%D$$p3 o$3 vq$3 jqED$! E D$$UPD$ T$D$U $iED$D$ ED$E D$$B2EPED$T$ ED$E D$ $)?EE$ ;ET[]UED$E D$E$BUD$3 E D$$D$ $quEUT$U T$$uEUT$U T$$LUED$E D$$蘵UD$ ' ED$E D$$UED$E D$$UED$E D$$wUD$" E D$$tsUD$" E D$$D$$lUD$D$ ED$E D$$:E$ƞ$pED$# U T$$;tqUD$# E D$$~UPD$ T$D$U $fUD$D$ ED$E D$$n@ED$( U T$$tnUD$( E D$$UPD$ T$D$U $%fUD$D$ ED$E D$$?1ED$' D$D$  UT$U T$$ U(EEE D$ D$R $]nE@uED$E D$E$EE @D$T$ ED$E D$E$288tD$$3 jE D$T$ ED$E D$E$q,‹EP EE;EUWS`CEEEEED$E D$E$D$, E D$E$UE D$T$$EE]؋E$E؋tEEjEЋD$ D$3 $lu>}tD$, $zkEЋD$$\kEEE;E|D$, E D$E$EȉD$$;E썅f=D$3 E D$E$kt4D$3 E D$E$D$D$4 $bD$, E D$E$t.D$, E D$E$\EĉD$$蒝EEątUċE9t $4 -EE+EEEЋT$$lt EE;E|͋E;Eu $ . u-Eą EED$E D$E$BEED$E D$E$zEEL$D$ T$D$D4 $aD$3 E D$E$+D$$M4 (k^EED$E D$E$EEL$D$ T$D$S4 $aEED$E D$E$6EED$E D$E$nEEL$D$ T$D$D4 $`D$3 E D$E$D$$M4 juVEED$E D$E$EEL$D$ T$D$S4 $`}tD$;. $gD$$gEE9ER}UM4D$T$ D$D$`4  $_88tE4D$$|4  eU4E T$D$ ED$E D$E$&‹EP E@ D$e. E D$E$HE $LU4 D$D$$aD$e. E D$E$YUPD$ T$D$U $^D$D$ ED$E D$E$I8$(hD$r. E D$E$E $!LU4 D$D$$H`D$r. E D$E$UPD$ T$D$U $]D$D$ ED$E D$E$7$`gD$' D$D$  ED$E D$E$0E $O‹E U( E T$$8‹E E $5i‹E E D$e. E D$E$E $JU4 D$D$$^D$e. E D$E$&UPD$ T$D$U $\\D$D$ ED$E D$E$6$e$4 b'UM4#D$ T$D$4  $[88tE4#D$$4 ha88tD$$5 Iat6U4#E T$D$ ED$E D$E$"Eԃ}uD$e. E D$E$wE $IU4 D$D$$?]D$e. E D$E$UPD$ T$D$U $ZD$D$ ED$E D$E$x4$WdD$r. E D$E$E $PHU4 D$D$$w\D$r. E D$E$UPD$ T$D$U $YD$D$ ED$E D$E$3$cD$' D$D$  ED$E D$E$_}ED$$YEEE EnE EOE EUPD$ T$D$65 $X88tD$$@5 k^$ZE EE EЃEmE}tD$, $t^EЋ̻D$$V^EEE;E|D$, E D$E$D$$[EEEE D$D$5 $^}t4EE D$ D$D$5 $U2EE D$ D$D$5 $UED$$K]EE;E=}UM4D$T$ D$D$`4  $'U88tE4D$$5 ZU4E T$D$ ED$E D$E$f‹EP E@ D$e. E D$E$E $BU4 D$D$$VD$e. E D$E$UPD$ T$D$U $,TD$D$ ED$E D$E$-$]D$r. E D$E$E $AU4 D$D$$UD$r. E D$E$.UPD$ T$D$U $dSD$D$ ED$E D$E$-$\D$' D$D$  ED$E D$E$E $GE‹E E $@‹E$ U( E T$$‹E EE $^‹E E u $4 ESE EUPD$ T$D$65 $R88tD$$5 W$TE EE EĻĻЃEmEM$谂ED$E D$$zt]t0D$%7 $ RD$$Q D$D$6 $JE43uU43D$$HOtE`EEU43D$$Ou8E43D$%7 $QQEEU43D$$1QE9E|tUt0D$;. $PD$$PD$$pNE$UN88tf$(7 PD$$Y7 RNE43D$$p7 :ND$$7 $ND$$7 NU43D$T$ D$D$7 $7Ht.D$7 $OD$$OD$D$7 $GD$ D$D$U E$G88tED$$7 9MÐUSdE@ED$ 8 E D$E$t)D$ 8 E D$E$D$E$LED$-8 E D$E$Tt4D$-8 E D$E$D$E܉$eLE܉$9D$<8 E D$E$t.D$<8 E D$E$EUD$$LEloca@lhosf@tD$I8 E D$E$t1D$I8 E D$E$UD$$K $X8 cD$t8 E D$E$Bt/D$t8 E D$E$UD$$MKUTE E $6CU]E D$D$8 D$T$E܉D$ ED$\$ $Y‹E E u2E $*3D$$8 J$N88t $8  ME@d[]UWS0Eǀ4W]4WD$8 E D$E$X\$$E88tE4WD$$8 $JEEEU8[ED$L$$FEUO[@EEMU0[@<.upEMU0[@U8[EPE U8WED$L$$EEUOW@;E]U8[EE}Ѓ98EE4W;E88$9 @K$x9 4KEEU8WEU8[EL$ D$ED$$9 zHEE4W;E$9 JE8_E4Wt/D$9 E D$E$-U8_D$$GE8_uEǀ4WE8_$覔0[_]U(E@u E: E u E: E u E: E u E: EE ED$E $]KuzE Eu E: vE Eu E: RE E$蕒E EEEE( ;EIE: EU(E@u E: E u E: E u E: E u E: E4WEE ED$E $JE Eu E: KE Eu E: $E E$GE EEEE( ;EE}xD$ D$D$$?݅݅xɍD$0D$,\$$\$ED$D$D$D$ D$D$; E$>E$?t $? >$ ?8AtD$A$< o;l;h; d;D$ T$L$$< F;$< =$< =$= =D$$T=  ;88t{l;h; d;D$ T$L$$= :$= >=$= 2=$= &=$ > =D$$<> :$k>  <$> <$>UX_@8tmD$; $B9E}tPE$NE܉$SMẺD$E$8ED$E܉D$ ẺD$D$> E$:@t<@8uED$$> 9D$$@ $=$> ;$t> ;ED$$? c9$3? ;$F? ;$o=U(E$U? ;$`? ;h; d;ED$ T$L$$? 8$? T;ED$$? 8$@ 2;$D@ &;$p@ ;EEE PEE T$ D$ED$$@ l8}t_EEx5EE %EE$_D$$@ $8EED$$@ 8$@ k:EE;EM$@ O:UWDEED$$7ЃEE88t $A 9ЃEE*E<]tE<}uEE EE;E|΋E;Eu3D$E$688$4A I9EE*E<[tE<{uEE m}yЃ}y_E<]u EƄE<}u EƄD$$*6EƄPED$$5UE)ЃƄEE<{uED$D$bA $&0}u D$D$gA $0ED$D$$%uJ88t $lA 7D$D$D$ ED$E D$E$188t D$D$$A  5D$D$$wpD_]UWS0ED$ D$D$A $/D$ D$D$A $.ED$E$E4D$A E D$E$ND$H; $K8|D$E$4E}ZD$E$4E}8UE)ȃUD$T$$d0UE)ljƄED$$u388ttNNЍXNNЍP\$D$ T$D$$A 3D$ D$D$4B $5D$D$D$ D$E D$E$88t4D$D$ D$D$$88t D$D$$tP UPD$ T$D$E $$EEED$D$ D$D$P E$vE;Dž;P Dž:;;:([U D$D$B $D$E$ӭt)D$E$ͩD$$HhD$E D$E$螂t0D$E D$E$-D$$D$$$p"UPD$ T$D$E $#$DE88tED$D$$P ED$D$E E$AE:Dž: Q Dž::::(XED$$D$E$7t)D$E$1D$$hD$E D$E$t0D$E D$E$葁D$$\D$$BUPD$ T$D$E $LD$xD$|D$ D$D$$H|D$D$E E$1E:Dž:Q Dž: :::(XE D$$KD$E$薪t)D$E$萦D$$ hD$E D$E$at0D$E D$E$D$$D$$UPD$ T$D$E $LD$xD$|D$ D$D$$.GxD$D$E E$E:Dž:Q Dž: :::(PE D$$D$E$t)D$E$D$$jhD$E D$E$}t0D$E D$E$O~D$$D$$UPD$ T$D$E $SLD$xD$|D$ D$D$$ED$E$wfE:Dž:(Q Dž: :::(PE D$$D$E$\t)D$E$VD$$hD$E D$E$'|t0D$E D$E$|D$$D$$gUPD$ T$D$E $LD$xD$|D$ D$D$$CD$E$E:Dž:4Q Dž: :::(E D$$xD$E$åtAD$E$轡UPD$ T$D$E $D$E D$E$vztED$E D$E${UPD$ T$D$E $;,EPT$ D$D$E $ ED$$p?gE:Dž:?Q Dž: :::(E D$$D$E$]t)D$E$WD$$hD$E D$E$(yt0D$E D$E$yD$$D$$hED$$@BE:Dž:KQ Dž: :::(E:Dž:WQ Dž: :::(tIE:Dž:dQ Dž: :::(E:Dž:KQ Dž: :::(uE D$$EE:Dž|:WQ Džx: :|:x:(uE D$$EEt:Džp:dQ Džl: t:p:l:(uE D$$RED$E$薡t)D$E$萝D$$ hD$E D$E$avt0D$E D$E$vD$$D$$UPD$ T$D$E $LD$xD$|D$ D$D$$.>}u|D$D$E E$}uxD$D$E E$g}LD$E$Eh:Džd:oQ Dž`:h:d:`:(ED$$bED$D$ ED$E D$E${88tED$D$$xQ 2E$.88ED$$Q E\:DžX:Q DžT: \:X:T:(E D$$T$ D$D$A $D$$ttD$E$88ED$D$$Q EP:DžL:Q DžH: P:L:H:(E D$$D$E$םt+D$E$љD$$jD$E D$E$rt2D$E D$E$/sD$$tD$$ZD$E$ED:Dž@:Q Dž<:D:@:<:(ED$$cD$E$讜t+D$E$記D$$OjD$E D$E$wqt2D$E D$E$rD$$D$$D$E$E8:Dž4:Q Dž0: 8:4:0:(E D$$:D$E$腛t+D$E$D$$jD$E D$E$Npt2D$E D$E$pD$$D$$nD$E$wfE,:Dž(:R Dž$:,:(:$:(ED$$D$E$\t+D$E$VD$$jD$E D$E$%ot2D$E D$E$oD$$wD$$]D$E$N=E :Dž: R Dž: :::(E D$$D$E$3t+D$E$-D$$jD$E D$E$mt2D$E D$E$nD$$QD$$7D$E$%E:Dž:R Dž : :: :(tIE:Dž:$R Dž: :::(E D$$zD$E$ŗt+D$E$迓D$$jD$E D$E$lt2D$E D$E$mD$$_D$$ED$E$E9Dž90R Dž9 999(E D$$QD$E$蜖t+D$E$薒D$$jD$E D$E$ekt2D$E D$E$kD$$6D$$ƅD$E$vE9Dž9:R Dž9999(ED$$!D$E$lt)D$E$fD$$hD$E D$E$7jt0D$E D$E$jD$$D$$w99Ѓuj|$T$L$\$t$ D$D$@R $b99Ѓuj|$T$L$\$t$ D$D$@R $D$E$8'E9Dž9OR Dž9999(ED$$D$E$t)D$E$D$$hD$E D$E$gt0D$E D$E$whD$$BD$$(ED$$hE9Dž9VR Dž9 999(rE D$$??:?@?:??@D$E$t)D$E$ۍD$$VhD$E D$E$ft0D$E D$E$;gD$$D$$??:?f@?99ЃuNL$\$T$ D$D$`R $99Ѓuo|$T$L$\$t$ D$D$@R $LZ99Ѓt+99Ѓuo|$T$L$\$t$ D$D$@R $99Ѓuj|$T$L$\$t$ D$D$@R $D$E$XGE9Dž9jR Dž9 999(GE D$$D$E$=t)D$E$7D$$hD$E D$E$ct0D$E D$E$cD$$bD$$H88t@99ЃD$D$$xR 99ЃD$$|$T$L$\$t$ D$D$R $88t@99ЃD$D$$R %99Ѓt/99ЃT$ D$D$A $$E} ~p.m.@} ~#m a.m.@}uE ȍD$T$L$ ED$D$R $]D$E$E9Dž9R Dž9 999( E D$$bD$E$褊t)D$E$螆D$$hD$E D$E$o_t0D$E D$E$_D$$D$$99Ѓt+99Ѓu7D$$>ƅD$E$"|9|9Ѓ|$T$L$\$t$ D$D$R $ D$E$tcEx9Džt9R Džp9 x9t9p9(E D$$D$E$Yt+D$E$SD$$4jD$E D$E$"]t2D$E D$E$]D$$D$$D$E$K:El9Džh9R Džd9 l9h9d9(E D$$D$E$0t+D$E$*D$$jD$E D$E$[t2D$E D$E$\D$$]D$$CD$E$"E`9Dž\9 S DžX9 `9\9X9(4E D$$D$E$t+D$E$D$$jD$E D$E$Zt2D$E D$E$_[D$$D$$vEE<,u EƄEUT9T9Ѓ9rD$E$锽EP9DžL9S DžH9 P9L9H9(E D$$?D$E$芄t+D$E$脀D$$迬jD$E D$E$SYt2D$E D$E$YD$$mD$$SD$E$|kED9Dž@9 S Dž<9 D9@9<9(NE D$$D$E$aD$E$WD$$8989ЃuD$E$遻4949Ѓt+0909ЃwEf @T$ D$D$A E$wD$E D$E$JWD$E D$E$WD$$,9,9ЃuD$E$`O(9(9Ѓt+$9$9ЃwEf @T$ D$D$A E$E鴹 9 9ЃuD$E$o99Ѓt+99ЃwEf @T$ D$D$A E$eԸE9Dž9,S Dž 9 99 9(E D$$D$E$t+D$E${D$$ϰjD$E D$E$Tt2D$E D$E$"UD$$}D$$cD$E$髷E9Dž97S Dž9 999(E D$$VD$E$~t+D$E$zD$$jD$E D$E$jSt2D$E D$E$SD$$nD$$TD$E$邶E8Dž8BS Dž8 888(E D$$-D$E$x}t+D$E$ryD$$ejD$E D$E$ARt2D$E D$E$RD$$D$$D$E$jYE8Dž8OS Dž8888(ED$$D$E$O|t)D$E$IxD$$ľhD$E D$E$Qt0D$E D$E$QD$$tD$$Z88ЃufL$\$T$ D$D$VS $aD$$ɽtD$$R D$E$脽sE8Dž8cS Dž8 888(8E D$$D$E$izt)D$E$cvD$$޼hD$E D$E$4Ot0D$E D$E$OD$$莼D$$t88t@88ЃD$D$$pS K<:uk88Ѓu@88tD$$S ƅED$$_頱88Ѓ vk88tD$$S 肻T$ D$D$A $谵ED$$ɓ ED$$: 豓E8Dž8S Dž8888(1ED$$蝺D$E$wt)D$E$sD$$]hD$E D$E$Lt0D$E D$E$BMD$$ D$$88t@88ЃD$D$$S ʹ<:ud88Ѓu988tD$$S lED$$ƒ&88Ѓ vk88tD$$S T$ D$D$A $6ED$$0鐮ED$$: xE8Dž8T Dž8 888(E D$$#D$E$nut)D$E$hqD$$hD$E D$E$9Jt0D$E D$E$JD$$蓷D$$yƅPED$$譒IE8Dž8T Dž8888(ED$$D$E$?tt)D$E$9pD$$贶hD$E D$E$ It0D$E D$E$ID$$dD$$JƅPED$$8E8Dž8"T Dž8 888( E EE D$$趵D$E$st5E؍D$E$nD$\$$ ~D$E D$E$GtD$E$D$E$ED$D$dT $fT tED$D$dT $: tE$!O骠E 8Dž8jT Dž8 888(E D$$UD$E$gtvD$E$cD$E$EEE<'u EE`EUE88Ѓ9r麟D$E D$E$<t}D$E D$E$<D$E${EEE<'u EE`EUE88Ѓ9rEE<'u EƄ`EU 8 8Ѓ9rD$E$鯞E8Dž8tT Dž8888(ED$$ZD$E$et+D$E$a‹ED$$ D$E D$E$n:t2D$E D$E$:‹ED$$鸝ED$$鞝E7Dž7|T Dž7 777(E D$$ID$E$dD$E$`D$E$EEE<"u EE'EUE77Ѓ9rE$韜D$E D$E$9D$E D$E$9D$E$\EEE<"u EE'EUE77Ѓ9rE$EE<"u EƄ'EU77Ѓ9r$rD$E$舥wE7Dž7T Dž7 777(E D$$"D$E$mbt)D$E$g^D$E$ԚD$E D$E$87t0D$E D$E$7D$E$蕤鄚D$E${jE7Dž7T Dž7 777(8E D$$88tD$$T D$E$AaD$E$7]D$E$赣ED$D$: $: tED$D$: $: ntED$D$: $OG NtE$9D$E D$E$5D$E D$E$(6D$E$ED$D$: $: tED$D$: $: tED$D$: $OG tE$`zD$D$: $: \tݍD$D$: $: 9tݍD$D$: $OG tݍ$D$E$E7Dž7T Dž7 777(jE D$$蔡88tD$$T 蕡D$E$^tTD$E$ZD$E$8ED$D$T $: tE$D$E D$E$`3t[D$E D$E$3D$E$轠ED$D$T $: tE$g遖D$D$T $: ctݍ$1D$E$G6E7Dž7T Dž7777(ED$$D$E$#]?D$E$YD$$蔟$[EE<~`E魈UPD$ T$D$E $ D7D7ЃD$@U $zt\@7@7ЃD$FU $4tD$@U $:88tD$$LU $!tGD$$"ED$D$ ED$E D$E$YfD$D$lU E$ՋDE<7Dž87U Dž47 <78747(+E D$$$D$D$ D$D$U $ēD$E$JUPD$D$ T$D$U $ފtD$$艒$D$$ ED$D$ ED$E D$E$$XЅE07Dž,7U Dž(7 07,7(7(tIE$7Dž 7U Dž7 $7 77(EE7Dž7U Dž7 777(uEt;EEUD$T$ $EUEd_E4E D$$覎E4D$D$B $褑88tD$$U 腎 7Dž7SH Dž7 777(WE4D$ D$D$4B $ 88X77ЍPE466ЃU4D$ T$D$$U |E4$X66ЍPE466ЃD$ ED$E D$E$mE4E4E4D$D$B $赏$'E466ЃЉD$ ED$E D$E$ m88tE4D$$,V 7EǀPED$ED$ ED$E D$E$Gr88ʁ$\V ZE4D$$V ҋE4D$$V 躋鉁E6Dž6a; Dž6666(Et;EEUD$T$ $菊UEd_E4E4ED$$D$ ED$E D$E$k88t$$V @E4D$$V 踊EǀPED$ED$ ED$E D$E$pSE6Dž6V Dž6666(u8UED$D$ D$D$$0E6Dž6V Dž6666(=ED$$聉D$D$W $88tD$$ W bD$ ED$E D$E$i88tE4D$$@W ED$E D$E$;U4E T$D$ ED$E D$E$J‹EP E@ t&Eǀ0 E $p$CN88a~$dW P~E6Dž6W Dž6 666(`E D$$D$ D$D$E $X66ЍP66ЃD$$dD$ ED$E D$E$hED$E D$E$:E88tEE4D$ D$D$$W E0 D$$W E0 UPD$ T$D$E $D$X $越r|D$ tD$E D$E$XtD$E$C2|UPD$ T$D$E $葀D$X $+{D$ tD$E D$E$ XtD$E$踅{E6Dž6X Dž6666(sED$$RD$ D$D$E $HX66ЍP66ЃD$$軄ED$D$ ED$E D$E$LED$E D$E$A88t'ED$ D$D$$(X hUPD$ T$D$E x$~xD$ pD$E D$E$5VUPD$ T$D$E x$H~xD$ lD$E D$E$UpED$T$ ED$E D$E$KEǀ_WlD$T$ ED$E D$E$KD$E$wE_PE_E_E|_9|xD$dX E$uE_D$E$ɂxD$sX E$uE`D$E$薂xD$X E$讆uEaD$E$cRxD$X E${uEbD$E$0xD$X E$Hu.E_i@_ED$E$wD$X E$u.E_i@`ED$E$要wD$X E$辅u.E_i@aED$E$aPwD$X E$yu.E_i@bED$E$ wE6Dž6X Dž6 666(#E D$$趀D$D$ D$D$U $袃<{66ЃƄD$E$9D$$uKD$E D$E$D$$D$$88t*D$ D$D$$X D$D$ D$D$)Y $y88tD$$>Y QD$C $yE}u$YY 薁tE%E$~E}tEUEEE$~t̋EEE$ tE6Dž6iY Dž6666(88t $|Y ݀E66Ѓu.$Y zD$ ED$E D$E$ssED$$}$qD$ ED$E D$E$ssE6Dž|6Y Džx6 6|6x6(,88t $Y E D$$3}D$D$ ED$E D$E$UD$D$Y $fw88tD$$Y |D$C $AwE}u88r$Z ~rE%E$V|E}tEUEEE$A|t̋EEE$詀(rEt6Džp6+Z Džl6t6p6l6(EE}^uE E D$${EE<_u EƄEUh6h6Ѓ9r${EU d6d6ЃD$${88t$ED$ ED$D$$4Z {D$E$/8t&D$E$)4D$E$zbD$E D$E$ t-D$E D$E$ D$E$ZzD$E$CzED$ED$E$6pE`6Dž\6jZ DžX6 `6\6X6(E E}^uE E D$$yEE<_u EƄEUT6T6Ѓ9r$yEU P6P6ЃD$$x88t$ED$ ED$D$$tZ xD$E$6t&D$E$2D$E$xbD$E D$E$ t-D$E D$E$z D$E$HxD$E$1xED$ED$E$nEL6DžH6Z DžD6 L6H6D6()E E}^uE E D$$wEE<_u EƄEU@6@6Ѓ9r$qwEU <6<6ЃD$$v88t$ED$ ED$D$$tZ vD$E$ 4t&D$E$0D$E$vbD$E D$E$t-D$E D$E$h D$E$6vD$E$vED$D$: $: tED$D$: $Z ظtED$D$: $Z 踸tED$ED$E$葦kE86Dž46Z Dž06864606(EEED$$.uD$E$y2t)D$E$s.D$$thD$E D$E$Dt0D$E D$E$D$$tD$$t88t'D$ ED$D$$Z ttE,6,6Ѓ }1uD$E$tE}2u!D$E$sE}3u!D$E$sE88t$D$ ED$ED$$[ s(6(6Ѓ Ei}1uD$E$6sE}2u!D$E$sE}3hD$E$rEhE$6Dž 60[ Dž6 $6 66(E D$$urEE<_uEƄ$}rE88tED$$:[ >rPED$E$`/t:PED$E$Q+D$D$E$nPED$E D$E$t>PED$E D$E$D$D$E$n&PED$D$E$m88tD$$Q[ 6qE66ЍPE9v@EE5EU66Ѓ9CE$vfE6Dž 6^[ Dž6 6 66(E D$$;pE~E<_gEƄ$CpEPED$E$B-t:PED$E$3)D$D$E$ilPED$E D$E$t>PED$E D$E$yD$D$E$k&PED$D$E$kE66ЍPE9vmEE.UE.UE.UE5EU66Ѓ9QE$JddE5Dž5i[ Dž5 555( E D$$nEE<_EƄ$nE88tED$$t[ mPED$E$*t:PED$E$&D$D$E$!jPED$E D$E$t>PED$E D$E$1D$D$E$i&PED$D$E$iE$rE55ЍPE9vmEE.UE.UE.UE5EU55Ѓ9*E$bE5Dž5[ Dž5555(ED$$kD$E$)t"D$E$%$k]ZD$E D$E$t)D$E D$E$h$k]$k]E\$D$O E$e`E5Dž5[ Dž5 555(EE D$$jD$E$'t"D$E$#$j]ZD$E D$E$t)D$E D$E$S$j]$uj]Ej wE\$D$O E$fd_Ej ٽn;n; fl;٭l;]٭n;Ej E]E\$ ED$D$[ E$cn_E5Dž5[ Dž5555(PED$$iD$E$d&t"D$E$^"$Ci]ZD$E D$E$6t)D$E D$E$$h]$h]Ej wMEٽn;n; fl;٭l;۝h;٭n;h;D$D$E E$b^Ej wEj ٽn;n; fl;٭l;]٭n;Ej E]E٭l;۝h;٭n;h;D$ ED$D$[ E$b]Ej ٽn;n; fl;٭l;]٭n;Ej E]Ej ٭l;]٭n;Ej E]E٭l;۝h;٭n;h;D$ED$ ED$D$[ E$fa\E5Dž5[ Dž5 555(E D$$fD$E$#t"D$E$$f]ZD$E D$E$t)D$E D$E$,$af]$Nf]E$iٽn;n; fl;٭l;]٭n;ED$D$E E$!`[E5Dž5[ Dž5 555(E D$$;eD$E$"t"D$E$$ee]ZD$E D$E$Xt)D$E D$E$$e]$ e]E\$D$O E$ _{ZE5Dž5[ Dž5 555(E D$$&dD$E$q!t"D$E$k$Pd]ZD$E D$E$Ct)D$E D$E$$d]$c]E\$D$O E$]fYE5Dž5[ Dž5 555(EU D$ D$D$4B $f5Dž5\ Dž5 555( $bE88tED$$\ b] 55ЍP55ЃD$D$B $+e] 55ЍP|5|5Ѓx5x5ЃD$x$yaD$9\ $eu D$E$UPD$D$ T$D$U x$[D$;\ E D$E$tOt5Džp5N\ Džl5t5p5l5(uE}t88t $T\ c}tOD$E$D$;\ E D$E$t\$ D$D$E x$Zx$88t*xD$ D$xD$$\ `LD$xD$|D$ D$D$x$謺EEE88t $L` JD$E$H=E4Dž4v` Dž4444(UUD$ D$D$E $J44ЍP44ЃPE44Ѓ9sl]44ЍP44ЃD$$F D$E$t,D$E$D$$aFD$E D$E$t0D$E D$E$CD$$F0E< tD$$E 88t D$D$$` ED$${F;88t $` HD$E$iEX;E4Dž4a Dž4 444(tIE|4Džx4a Džt4 |4x4t4(IU D$D$B $GD$E$D$$Du.D$E D$E$D$$TD7:p4p4ЃP El4l4Ѓ99U h4h4Ѓ‹ED$T$ ED$E D$E$PE$gu9Ed4Dž`4a Dž\4d4`4\4(UD$D$B $DFD$E$ot,D$E$iD$$BD$E D$E$7t0D$E D$E$D$$B7E< tD$$jB-1.0@$Buz,8X4X4ЃP ET4T4Ѓ9sTU P4P4Ѓ‹ED$T$ ED$E D$E$IEE$Xsr7EL4DžH4&a DžD4L4H4D4(UD$ D$D$E $+DD$E$Mt,D$E$GD$$@DD$E D$E$t3D$E D$E$D$$o@utEd_tgEd_D$$tF88t $0a BEd_D$$pD$$?pu3D$$萏t88t>$Xa ;B0E< tD$$? $ r@4@4ЍP<4<4ЃP E8484Ѓ9sl] 4444ЍP0404ЃD$$> EE<+u EƄ EU,4,4Ѓ9r88t4D$D$ D$D$$a  >EE<^u EƄ EU(4(4Ѓ9rD$$Al3D$E$c=R3E$4Dž 4a Dž4 $4 44(tIE4Dž4a Dž4 444(U D$ D$D$E $?D$E$t,D$E$D$$]Ed_D$$ D$$;pu3D$$+t88t>$Xa =0E < tD$$; 4 4ЍP44ЃP E44Ѓ9sl] 44ЍP33ЃD$$1: 88t4D$D$ D$D$$a  :E-E<^tE<+u EƄ EU33Ѓ9rD$$=Z/D$E$Q9@/E3Dž3$b Dž3333(UD$ D$D$E $;D$E$t,D$E$D$$8DD$E D$E$t3D$E D$E$rD$$=8utEd_tgEd_D$$atF88t $0a x:Ed_D$$>D$$7pu3D$$^t88t>$Xa  :0E< tD$$R7 $i33ЍP33ЃP E33Ѓ9sl] 33ЍP33ЃD$$V6 E-E<+tE<^u EƄ EU33Ѓ9r88t4D$D$ D$D$$0b 5D$$jEE:EED$$9uD$E$Q5E9E|1+E3Dž3qb Dž3 333(U D$ D$D$E $7D$E$ t,D$E$D$$4DD$E D$E$t3D$E D$E$cD$$.4utEd_tgEd_D$$RtF88t $0a i6Ed_D$$/D$$3pu3D$$Ot88t>$Xa 50E < tD$$C3 $e33ЍP33ЃP E33Ѓ9sl] 33ЍP33ЃD$$G2 E-E<+tE<^u EƄ EU33Ѓ9r88t4D$D$ D$D$$b 1D$$fEEE,EED$$5uEE9E|Ƀ}$'D$E$1 'E3Dž3b Dž3 333(hU D$D$B $3U 33ЃtD$E$D$$N0$bu llD$D$e $e htݍlD$ lD$D$e $D$E$'lt5lD$D$Be $D$E$_'lt5lD$D$Me $bD$E$'D$c E$ 'E9ED$Qe E$&EEE;E^}gD$ae E$&OD$D$pe E$'U D$ D$D$E $'88t D$D$$|e #Ed_t7Ed_D$$D$D$e $88tD$$e #Ed_toEd_d_t=Ed_d_D$$D$D$e $88tD$$f #D$E$RD$D$e $Eu6D$E D$E$迵D$D$e $D$$J#V] X3X3ЍPT3T3ЃD$$!D$D$ ED$E D$E$~D$E$!D$ D$Df E$$mU D$ D$D$E $r$88t D$D$$Pf I!D$E$D$$!u.D$E D$E$D$$ uD$$ D$E$D$${ u.D$E D$E$uD$$@ uD$$ 88t D$D$$f  D$$ ]P3P3ЍPL3L3ЃD$$hD$D$ ED$E D$E$D$E$&D$D$f E$V"mUD$ D$D$E $!88t D$D$$f D$E$D$$ru.D$E D$E$lD$$7uD$$D$E$pD$$u.D$E D$E$D$$uD$$88t D$D$$(g D$$*6]H3H3ЍPD3D3ЃD$$D$D$ ED$E D$E$^D$E$D$D$wg E$ED$$VE, 6D$D$ ED$E D$E$$ND$E$D$D$g E$"ED$$E,  )ȃD$D$ ED$E D$E$$MD$E$>-D$D$g E$nUD$D$B $D$D$ ED$E D$E$|$[M$EU@3@3ЃtE, }ЅKtD$T$ ED$E D$E$D$E$D$ D$g E$EVU D$D$B $D$D$ ED$E D$E$S$2L$E88tG<3<3ЍPED$ T$D$$g QU 8383ЃtE, }ЅtD$T$ ED$E D$E$dD$E$D$ D$g E$g E D$$\EƅEUEE< u؋EƄ88tD$$g PED$$88tD$$g D$$ MEܡ88tD$$h D$ D$h $E D$E$D$$'u1 D$E D$E$D$$88t#P D$T$$,h 4343Ѓu7T$ D$D$A $0303Ѓ u7T$ D$D$A $u,3,3Ѓu4T$ D$D$A $](3(3Ѓ v2T$ D$D$A $88D$$ch 1D$ D$zh $>;88t D$$h  D$E$D$$u1 D$E D$E$葧D$$\$3$3Ѓu7T$ D$D$A $v 3 3Ѓ u7T$ D$D$A $33Ѓu4T$ D$D$A $ ]33Ѓ v2T$ D$D$A $S 88SD$$h 8D$ D$h $488t D$$h  D$E$D$$9u1 D$E D$E$0D$$33ЃvNL$\$T$ D$D$i $ 88D$$ i vD$E$t,D$E$D$$D$E D$E$貣t0D$E D$E$D$$ID$$p`u-u D$D$$88tD$$#i t88t/D$E$D$D$$?i <88t D$D$$\i EEEE܋D$D$i $< EE܋D$$uD$i $D$c $EE܋D$$D$c $D$E$uE9E1D$ D$i E$BgE D$$EƅEUEE< u؋EƄ88tD$$i PED$$O88tD$$i PD$$CEܡ88tD$$i D$E$8t)D$E$2D$$ hD$E D$E$Qt0D$E D$E$蒠D$$] D$$]u D$D$$A88tD$$j  EEUEE܋D$$u0U9} U܃ED$E$E9E|wD$>j E$u6D$E D$E$ɘD$E$; *D$Kj E$SuE4#$D$ D$Zj E$?E D$$ 33ЃEExMEE ‰L$D$$uJEE PEE T$ D$D$hj $D$E$y EE;E| D$E$ZtD$E$ ED$E$3tIED$E$0D$$ $r<D$E$ zEd_tmEd_‹ED$$tOEd_‹ED$$D$$/ $;D$E$ [^_]U(EEBk2O@m3y7@TDnB@ D$j E D$E$nt,D$j E D$E$豜D$$| ED$ D$D$j $D$C $E}ED$D$$5E$z $;D$$N>EEED$E$EtBED$j $ t)D$I E$ ED$E$ 9Et*D$I E$ ED$E$q U(D$c E D$E$UPD$ T$D$E $LUˆD$ T$E D$E$EEEU4#D$D$k $88tE4#D$$k eED$E D$E$t)EED$$k #H88t!EiED$$l E $o ‹E E t!E tE u$EED$$8l E E T$ D$D$jl $D$$u]D$$KED$T$ ED$E D$E$D$E$EE;E UED$E D$E$kU4#E T$D$ ED$E D$E$_‹EP E@ t EE4#D$D$ql $.t EE $‹E E $ ‹E$ E $‹E( U( E T$$‹E E$ EEU(ED$E D$E$=U4#E T$D$ ED$E D$E$1‹EP E@ t EtE4#D$D$ql $t EGE $‹E E $EE $QEEEUWEEE<"u E/EUEE}Ѓ9rEE_]UW$EEEE<"uEEUEE}Ѓ9rǡ88tED$$xl E$_]UWSĀEEE EE$ED$ED$ E D$D$B E$|E E}ЃUEE}Ѓ‹EE}ЃED$l E$u9E $3]E$%EwED$E$D$_ E$u9E $]E$EztED$E$UD$c E$ru7E $]E$EwED$E$D$l E$$u9E $E]ȋE$7EsED$E$D$l E$u7E $]ЋE$EsED$E$iD$l E$u9E $]؋E$EuzED$E$D$l E$6E $S]E$EEuzED$E$E$sD$"E$EED$"$EUE)ȃUD$T$E $M UE)É؍ED$"$EED$"$EUE)ljUD$T$E$MUE)É؍88t\EE}ЍXE E}ЍP\$ED$ T$E D$$l UED$D$B $fE$088tED$$l ?D$l E$<u0ED$E $&yED$E$D$_ E$u0ED$E $uED$E$[D$c E$u0ED$E $~ED$E$OD$l E$gu0ED$E $QED$E$D$l E$ u0ED$E $ xED$E$D$l E$u-ED$E $tED$E$zBD$l E$u+ED$E $tED$E$6[_]U(EEE EEs#Em }E fEm]m!Em }E fEm]mE܉EE]EU(EEE EEs+Em  m }E fEm]m)Em  m }E fEm]mE܉EEm ]EU(EEE EEs+E(m 0m }E fEm]m)E(m 0m }E fEm]mE܉EE(m ]EU(EEE EEs+E8m @m }E fEm]m)E8m @m }E fEm]mE܉EE8m ]EUW$E E EEE4D$$ЃEEEf@, @.D$E$E؉D$D$hm $ D$E$m ED$T$ $D$E$ @D$E$d <@td v@alig@ n=to@p cl@ass=@"gra@phbo@ rder@$" wi@(dth=f@,1>@.D$E$@0 @6D$E$tEǀ, EE $‹E E UԉĜD$L$$zUԉU-cE $]EEwE]EąucE$0ٽ<< f<٭<۝<٭< D$E$ @D$E$E؉D$D$hm $D$E$wm ED$T$ $uD$E$@ @D$E$o uD$T$ $D$E$EEԃUԉĜЉD$D$p $D$E$E$ ;E~2EȉD$D$lp $D$E$ f@ D$E$ @D$E$o uD$T$ $D$E$q yD$T$ $D$E$wEUԉ )ȃUԉĜЉD$D$p $MD$E$E$ ;E~2EȉD$D$r $ D$E$EE$ ;ED}
  • @.D$E$4EȉD$D$r $GD$E$r rD$T$ $D$E$ @D$E$E؉D$D$hm $D$E$mm ED$T$ $kD$E$6f@ @ D$E$d[]UWdEE}Ѓu'ED$Eȉ$pEȃ D$E$[EЋET$ D$D$A E $E $`E} ~Ep.m.@} ~ m Ea.m.@}uE EȋEЍED$L$T$ ED$D$R E $#d_]US$D$Ps E$u ED$Xs E$u ED$`s E D$E${u EEt_u:]t_D$`s E D$E$|\$$T‹Ex_Et_u ERE4Ex_EED$$u EEEt_;EEE$[]UH*EE$7D$E E D$E$S{$hE}uTD$E E D$E$({D$T$ ED$E D$E$i$ED$E E D$E$z$ED$ms E D$E$z$E荅D$|s E D$E$ zt,D$|s E D$E$czD$$.E4#D$$D$P $E}tEEEv ٽ f٭]٭E}~EEEE;E|E88t!ED$ ED$ED$$s 88t!E܉D$ E؉D$ED$$s V} D$s E D$E$5y$JE}~}~EE@,
    D$E$D$s E D$E$wD$D$ t $D$E$}^EU)ȉE}yEEEEEE;E~EED$D$,t $D$E$W @D$E$,D$Mt E D$E$vD$D$\t $(D$E$D$D$t $D$E$ED$D$t $D$E$|UE)ЉD$D$t $D$E$EED$D$u $XD$E$ED$D$Tu $&D$E$ED$D$u $D$E$t7D$D$u $D$E$mc @&D$E$ D$E$ f@ D$E$}u}tAD$v E D$E$_tD$$*D$E$e}QE4EEEEEEEE;E~EED$D$,t $:D$E$ @D$E$D$Mt E D$E$sD$D$\t $D$E$D$D$t $D$E$LED$D$t $_D$E$EED$D$t $)D$E$ED$D$u $D$E$ED$D$Tu $D$E$ED$D$u $D$E$NtKEԃUԃD$D$ T$D$v $=D$E$5EԃD$D$Tv $D$E$ D$E$ f@ D$E$kEԃ;E}AD$v E D$E$qD$$D$E$EE;ED$s E D$E$bpD$t E D$E$@ptKD$t E D$E$pD$D$t $D$E$=D$E$BD$s E D$E$oD$D$ t $>D$E$}-EEEEEEEE;E~EE}u}t,D$v E D$E$xoD$$CD$D$,t $D$E$^ @D$E$3D$Mt E D$E$nD$D$\t $/D$E$D$D$t $D$E$ED$D$t $D$E$EED$D$t $D$E$NED$D$u $aD$E$ED$D$Tu $/D$E$ED$D$u $D$E$t7D$D$xv $D$E$v\ @"D$E$ D$E$ f@ D$E$ @D$E$U8EEhttp@://w@ww.c@ oold@ogin@tera@ctiv@e.co@ m/ne@$ws/n@(ews4@,.xml@0D$D$v $#Eǀ|_Eǀ_D$C $E}%E$9E}tEU䈔EE$$u }~ËEƄE$D$v $E}D$v $E}tE;EsE_D$E$b88tE_D$$v D$v $YE}tE;EsE`D$E$88tE`D$$w PD$)w $E}tE;EsEaD$E$88tEaD$$/w D$Mw $E}tE;EsEbD$E$E88tEbD$$Xw Eǀ|_EE.D$v E$'E}u EED$yw E$E}u ED$v E$E}tE;EvE|_i@_E)E|_i@_ED$E$LD$v E$gE}tE;EvE|_i@`E)E|_i@`ED$E$D$)w E$E}tE;EvE|_i@aE)E|_i@aED$E$tD$Mw E$E}tE;EvE|_i@bE)E|_i@bED$E$E|_PE|_E|_~E}88EED$$w Ei@_ED$$w Ei@`ED$$w Ei@aED$$w Ei@bED$$w EE|_;EGUEE EEEEt E<>uEEU EEEE<tE<EED$D$H $ҷD$$芿EE;ED$E$D_]UW4EЃ=vDžEuDžEuDžED$E$eE}u DžfEЃED$$8D$ E D$D$E E$蔶Dž4_]UW$D$/E$^tEЃEEmEuEEEEt }~EƄ88tD$$by iD$E$4U(D$y E D$E$5MED$$kEE[EFEEEE T$$uEE @D$$EE;E|EE9E|D$y E D$E$LED$$EE[EFEEEE T$$`uEE @D$$NEE;E|EE9E|D$y E D$E$LED$$7EE[EFEEEE T$$ƼuEE @D$$EE;E|EE9E|D$y E D$E$gKED$$EE[EFEEEE T$$,uEE @D$$EE;E|EE9E|UWS EEEE}ЃEE E}t^} }t}t}E"E]EE$UEE;E|OE"E]EE$ EE;E|ErE]EE$}t,}~DUE< tUE<'uE]EE$腳EE;E|E'EE<`~EEEE @D$ D$D$4B $D$D$P $QED$E D$E$ptED$D$Z $ED$E D$E$"tE$臅ED$E D$E$KUPD$ T$D$E $}tCD$E D$E$UPD$ T$D$E $8$EE  ٽ f٭]٭88t.ED$ED$ D$D$$ XE;E~K}u}u?ED$ ED$D$@ $~U4 D$$5EE;E}t[]UWDEED$ E D$E$\ugEMEE D$ $菇&EE @D$D$ D$D$B $;D$D$Z ${}ED$E D$E$LtE$E$ED$E D$E$UPD$ T$D$E $|}tCD$E D$E$iUPD$ T$D$E $|ED$ED$D$ D$E D$E$}D$$}tD$$譁EkEE D$$赅uDEE @PEE @ЃjpgEE;E|EE;ED_]U$ }E}tED$E$T$J e}E}t3D$?E$9}E}tED$E$蛀 $ VFUW$$ }E}tED$E$]$z |E}tED$E$1$J |E}tzD$ E$E}t^ED$E$EEED$Ȋ E D$E$Q UPD$ T$D$E $rUPD$ T$E D$E$J/tmp@D$ E D$E$v tAD$ E D$E$ UPD$ T$D$E $q88tD$$ pwD$D$D $q$D$ D$D$S $xq88tD$$h vD$L $cvE}u $ wED$$GE$>uD$ ED$E D$E$D$E D$E$D$D$ D$D$ċ $kp$r$wD$D$Ջ $1pD$ۋ E D$E$D$ D $yt$%rED$E D$E$UVS D$ E D$E$D$ E D$E$zD$ E D$E$XD$ E D$E$D$$tu,D$. E D$E$D$$tE$D$ E D$E$D$ E D$E$fD$ E D$E$J‹M4D$\$ED$t$ T$D$8  $onU4E T$D$ ED$E D$E$5‹EP E@ tE $\$Z9 [^]U8fkls@fjaj@fslk@ jlad@itemf@sE0 it@ems @/ $ @ 0.00@E0 it@emsEf0D$\ E D$E$D$ T$E D$E$E}$fuD$C $7rE}D$ ED$D$f E$uE$;qEuitem@݅U\$D$ T$D$m E$lUD$ T$D$} E$qlED$D$E E$WlUWVSl/car@t/us@ersD$ E D$E$Wt,D$ E D$E$D$$eqEЃtDžD$ED$Eԉ$mED$E D$E$ EEEEEEEEЍEԉD$0L$,\$(t$$|$ D$|$D$T$D$ D$D$ E$jDžl[^_]U(E$nE}tE$zpE7D$C E$oE}u EE$nEEUE$4nE}tE$pEEEU(EE$zE88tED$$ qoD$C E$nE}uRED$D$ $i$4%E$nE}t)EU EEE$nu }~ËE$mEE U}u E z}u E k}u E \}u E" M}u E) >}u E: /}u E  }u E2 } u E- EEEUD$6 E D$E$D$< $ru 88D$6 E D$E$D$@ $qu 8888t48u1U(E+EE D$E$qu EEE;E|EEU(E>EE D$E$EquEE @t EEE;E|EEU(E3EE D$E$puEE @EEE;E|E: EU(E2EE D$E$puEEEEE;E|E EUWVSlEEEE$C hE}E$/lE̡88tẺD$$R kẼ$lE}u $l v1$8$kEЃ} EЉE}&}&}%W}+}=tBEEE$E] uEE}Ѓ$-lEU Eu $l 0EU E‹ED$$jEEEEE$<}uMED$ E D$$D$H; $ntD$T E$nuEE] uEE}Ѓ$1kEU Eu $l /EU E‹ED$$iEE D$ $mu,EE @D$ D $mu <8EE D$ $mu,EE @D$H; $kmu <8ED$ E D$$4D$ D $1m EU E‹EE T$$lEE @E}ЍXU E@E}Ѓ$riE}u $l .EE PM E@T$ D$D$΍ E$bU E‹EBEPE EPEEEEE E$8$zgEܡ$8$jgEED$E܉$薔Eԡ<8t-}~}~ } t} uEȉUEԈ%m}~}EȉUEԈmE_EЉEԡ<8t-}~}~ } t} uEȉUEԈ%m}~}EȉUEԈmE}t }EEUEȍ<UEȍE$}uMED$ E D$$sD$H; $pjtD$T E$YjuEE] uEE}Ѓ$gEU Eu $l +EU E‹ED$$eED$ E D$$D$ D $i EU E‹EE T$$^iEE @E}ЍXU E@E}Ѓ$eE}u $l v*EE PM E@T$ D$D$΍ E$^U E‹EBEPE EPEE$bE؉EEEEE;El[^_]UW4#EE D$ED$$E E}E D$: ED$$it8E D$: ED$$D$D$$-`ZE D$: ED$$E D$: ED$$ND$D$$_ƅ$bD$ D$D$E $R]}umysq@ldb.@txt$}u&mysq@ldb_@pre.@ txtEEh_EЍHEh_EL$D$$geu4E88t$Eh_ED$$؍ aEEl_;ET88tED$$ a}uEl_tEp_}u}tED$$ha88tD$$8 iaD$C $`E}ug}uaD$D$a $[E D$D$ D$ } ED$ED$$ $e}D$D$B E$cE$j`uoED$D$$y]$<#t&D$ D$ED$E $ E$_SE$^88tE D$$ _EEEUEEE ;E4#_]UVS D$E$t$D$ D$ E D$E$ Et!ED$ D$O E D$E$@8ED$; $B^E}tm$s$9rD$$]ED$D$ D$D$> E$`_E$e]UED$E D$$.1D$ E$bUED$E D$$SD$D$$ZED$D$: $Ď tݍD$D$: $x Št݋UPD$ T$D$E $X88tD$$Ȏ ]$"UD$D$ ED$E D$$1$aED$ U T$$UD$ E D$$D$D$$YE$1UPD$ T$D$E $W$@t7UD$D$ ED$E D$$0$` D$$ Z\D$$0 D\EtED$$J '\$W ^$` \x;t; l;h;5p;D$T$L$ \$t$$ [$F? 6^$_UED$D$: $Ď mtED$D$: $x MtED$D$: $؏ -tED$D$: $  tED$D$: $ tED$D$: $ ͝tED$D$: $l 譝tED$D$: $c 荝tED$D$: $ mtED$D$: $ MtED$D$: $ -tED$D$: $  tED$D$: $e tED$D$: $ ͜tED$D$: $I 譜tED$D$: $ 荜tED$D$: $$_ mtED$D$: $ MtED$D$: $ -tED$D$: $Z  tED$D$: $E tED$D$: ${ ͛tED$D$: ${ 譛tED$D$: $ 荛tED$D$: $ mtU}u)E Ille@gal @prog@ ram @mode@}u2E No m@atch@ing @ reco@rds @founf@d}u+E Fail@ure @addi@ ng r@ecorf@d}u2E Reco@rd s@ucce@ ssfu@lly @addef@d}u3E Reco@rd s@ucce@ ssfu@lly @upda@ted}u2E Fail@ure @upda@ ting@ dat@abasf@e}u3E Reco@rd s@ucce@ ssfu@lly @dele@ted}unE Numb@er o@f do@ wnlo@ad r@ecor@ds f@ound@ was@$ zer@(o or@, mor@0e th@4an of@8ne@:} u%E View@ fil@e no@ t fo@und]UW$EE}Ѓ$EWEEE}Ѓ$WE}t}u $ ED$E$UED$E$UEU EEU EBEPE$_]UWVSlEEEE$ QE}EЃEȃ}EEčED$N E D$$t6ED$N E D$$D$D$(y $+OED$[ E D$$Ht6ED$[ E D$$D$D$(y $N88tEȉD$$R PTEȃ$BUE}u $l EEẼE} Ẻ&&%;+=t{EEE$0E] u܋EЃ$rTEU E܋u $l EU E܋‹ED$$SEEEEE$聅E$脗tKEE D$$St(E$REED$D$E E$Lt.EE D$$2St E$E] u܋EЃ$%SEU E܋u $l EU E܋‹ED$$QEEPEEEE EEEEԃEEEE؃EE؉D$Eԉ$r~EЃ}~}EUEЈmE)ẺEЃ}~}EUEЈmE}t }EEUE<UEE$ZE$]tKEE D$$cQt(E$PEED$D$E E$Jt.EE D$$ Qt E$E] u܋EЃ$PEU E܋u $l EU E܋‹ED$$OEPEE$MEĉEEEEE;El[^_]UW$EEEtMEEu4EE<_t'EE<-tEE<@t EE<.uUEEEEUEЃ9^EƄD$E$iN$_]UWVSLEEE$ JE}EE}ЃẼ}EEȡ88tẺD$$ MẼ$NE}u $ EEEЃE} )EЃ%E}U EEE$E] uEE}Ѓ$PNEU Eu $ EU E‹ED$$LEEQEEE$_E] uEE}Ѓ$MEU Eu $ *EU E‹ED$$=LEPEEEEE EEEE؃EEEE܃EE܉D$E؉$xEԃ}~}EĉUEԈmE)EЉEԃ}~}EĉUEԈmE}t }EEUEč<UEčE$}E] uEE}Ѓ$$LEU Eu $l EU E‹ED$$JEPEE$HEȉEEEEE;EL[^_]UWSEEEEP$C FE} E$fJE$t FEă} D$D$ Eĉ$?M} EE܋EăD$D$ $?DEăD$D$ $D88tEPtEPD$#y $FUPD$$F$8D$D$$;A$vE] Ѓ$DE] Ѓ$DCEE tEE @u $p & D$ D$D$E $=D$L $BE}u.D$D$ $t=$88tD$ED$$ BE^}~9}t3UԃE< u EE< tED$$ 8DEEЋED$$DE9E|E$#AD$D$" $<$>EE D$$AEE @D$$AEPEE] Ѓ $BE] Ѓ$gBCEE tEE @u $p EE D$D$1 $l;EE @D$$@EPE$3E؋E؉D$D$E $;ED$= E D$$5tCED$= E D$$vD$ T$E D$E$D$ D$N E D$E$j$8D$D$$=D$ D$D$Eԉ$Eԉ$RrED$ E D$$D$ D $CEU ED$$|CEԹЍXU E@Ѓ$?Ẽ}u $\ U EPEԉD$ T$D$΍ Ẻ$9U E‹ẺBE] Ѓ$_?E] EԹЃ$"?CEE tEE @u $ EE D$$=EE @‹EԉD$$=EE D$ $Au,EE @D$ D $Au <8EE D$ $VAu,EE @D$H; $4Au <8EPE$8D$D$$9$\oD$ܔ $@u E }E܉EEEEE;EĀ[_]U8D$ D$(y $6ED$D$? $6D$$D$ E $%ED$E$'uD$ E $%ED$ ED$D$ $D$E $%E};cUVSP \$t$ D$D$ Eԉ$88t"Eԉ$+#D$EԉD$$ "Eԉ$ #EE$[P[^]UE$8EZ~ ElE EEEUE$8EUE$8EUHEa.m.@ED$E$-"EE$^"EED$E$"EE$7"EED$E$!EE$"E} u Ep.m.@} ~m Ep.m.@}uE Ea.m.@EԉD$ED$ ED$D$ E $UW4E EEE}M}Yt}D;EE}ЃuGED$E$ EE$$!E}Z~ ElEwED$E$ EWEEܸ}Ѓu#ED$E$l EEEظ}Ѓ u#ED$E$' EED$E$ EEEԸ}Ѓu ED$E$EhEEи}Ѓ u ED$E$}E&ED$E$]EE4_]US4E* E1 E8 E@ EJ ES EZ UM Eث*E)ȉU)щʉ)ËE kE98E)ȍEX} ЋE)EQE)‰ЍP)Eؓ$IE )É؉EU)Љ)‰ЉEED܉D$E$4[]US4Ec Eg Ek Eo Es Ew E{ UM Eث*E)ȉU)щʉ)ËE kE98E)ȍEX} ЋE)EQE)‰ЍP)Eؓ$IE )É؉EU)Љ)‰ЉEED܉D$E$4[]UWE E$ hExxЃu|ED$E$uEE$lEED$E$IEED$Ẻ$0EE$aEẺ$SEWEttЃ E<-ED$E$EE$EEЋET$ D$D$A E$E ЋET$ D$D$A Ẻ$E$yEẺ$kErED$E$EE$EEED$E$EED$Ẻ$EE$EẺ$EE$0EZ~ ElE EEE+EEE;EE;Eu E;E|EED$D$E E $Ĥ_]UWEI EI EI EI EJ EJ E J EJ EJ E"J E*J E3J E E$jExxЃuGED$E$EE$lEED$E$aEEttЃ ufE<-uYED$E$EE$BEEЋET$ D$D$A E$L=ED$E$EE$EED$E$EE$TȋED$ T$D$ E $Ĥ_]UWVS,EuEM9u>\Vֈ>tS}tߋUM싂PdL$t$$REt1;]uCt>|u[^_]À>z[^_]À~VpF։dU1]É'UE M@Q Q ]Ít&UE U@J fB ]Ðt&UE U@J B ]Í&UE SM@Y PSA [] UE M@]Q EQ EBA Ðt&UUM Bpud]Ív@BpBp1] Ud]ÍUSU M]tr t"[]1[]Ð1[]Ív1[]ÍvUE]fUE]Px@tfUE]fUE]@| U t$E u$]|$H@S{ 8K-!Ј$t$|$]ÐU t$E u$]|$H@Sf{ 8K-!Ј$t$|$]U t$E u$]|$H@C{ 8K-!ˆ$t$|$]fU]]uu QEEUVVEB]u]ÍvUUER(]UWVSEUx vF   o&[^_]Ãt&i&<&uUzE@4`U$zE@L9Eth=P ;tRE;Ut*119 9UQ ƃuEP 9UuE@4UB8UBLwV*t&&E@8U1B mf t- ~E@81[^_]Äۉ„5:E@ U1B([^_]ÁiE@4t&O&E@4Uz76E@(U1B [^_]à n K t&pt&E@4Uz=UB4E@ U1B(E@4 U$zjjE@(U1B KE@ U1B(wdE@4UzE@4`Uz UpE@4U$zE@ UB8E@ U1B8E@4pUz[E@(U1B E@(U1B KvE@(U1B [E@4 UzvUWVS,ED$E$EEUE܉E쀺 E܉EZ4k<9ÉEz8E/CCu E<9]v:PC U܉uȋCECED$|$$S4C E뭋U؅tUt EeEǀEԃ,[^_]ËEǀ}dtUEԃ,[^_]Í&UUM BpJp] UE]@pÐt&U |$}$E t$UwHÄt u9t&ۉwpt tv$t$|$]LJLJۉщƒ6Ѕ uЉʃ뜍UE]P@@\t&UVSà eE1fEBEBEB EBEBEBErt> S EEL$D$$&s Ee3ug [^]ËJ t빍t&BuBu݋uBuBu1노q&UU E]R&'U8E PE܋BEBEB EBEBEBEBEB UEEEEEEÍUWVSE@,EUE}tQC D$E$a@ BCJ׍VD$T$ $|_EP뎃wFUF1[^_]ËEUD$ U苂\D$ЃUD$E$P[^_]ËE '[^_]ËE 'p넉'US]$ntC8P!‹E 1҃[]ÐU]]uu $;F vF ]u]fUS]$Ϋ[]ÍUWVSEM u71ҋ 'ƒ[^_]Ðt&]C49%kCCCuC [^]Ðt&@C CًB뽉$D$ [^]fUEU]@N&'UH]É}ωu@ EME؃{ wdC$T ED$ED$$s {-=MM؈t&]u}]Ív1C9w;sr@C 9s8ѐS)ƅt9։ D$E؉L$$<U2C 9s8늍ED$ED$ DI|$T$$HPXM]C EU؉EBDED$ED$ DIT$|$$HPXUEUK ] Ѕ ЈEM؉ED$ED$$觞K {-uE؉0ED$ED$$ds {-=UMf^M؍E$D$ |$L$UC 4ED$ED$$EUs {-}ED$E؉$D$ |$D$cES t{ uM؋A 1EӁw Ӂw ;9}!t&UWVSE^E ݅eE1`ٽ% f٭٭ݝx݅x~w F$ v؋GDD$\$D$ D$KD$D$貽$+DG@@tW9&ىEe3[^_]Í\$FL$=JvJD$D$ D$KD$D$D$ $Ր=ٽ% f٭٭ݝx݅xI؉D$Љ\$$GD$ KD$0)؉D$$軺_FL$=J~-$ݝH^ZC݅H~-N *+[+ݝx݅xAG؋C-ٝN ݅ɐ Ј~-3ٽrr fp٭p߽h٭rh~-N _1RP,$Ƀ듀~-ٽrr fp٭p۝d٭rdf~-N P$:ٽrr fp٭pߝb٭rbN ~-ufP$ɃfP$Ƀٽrr fp٭p٭rYٽrr fp٭p٭rٽrr fp٭p߽٭rC;4++ʷl t&'U]ËE}UuEE EeE1KM{ wTC$ {-s }w }w1SEEe3]u}]ÀU D$ E։ED$ET$$T+uG@@u؍U럋W9swED$EЉt$$DGMD$ D$0 $)D$w뢍EȋMD$UED$ L$T$$SuȅEUC EMEA1K 8S-t E UERP,$]ȋs }EM fMm}mM]11 EȋUẺBUERP,$]ȋs }EM fMm}mM]11 EȋU?{-K }w1EM{-s UMw ЃEUfUEU҉Em]E]ȋs E$UM]11 EUSUEU҉Em]E]E]ȋEȋs $@TM]11 UM€ Ѓ}}1l ml  UXueE1~ ]wF$ t&]։ $\$aډEe3>]u]É $TRP,$ډ$뻋FfF 뫋VABABA B ABABABABA B oVABABA B ABABABABA B F y )VABABA B ABABABABA B Q F  $PD$$T$l WvUXE }}]uP@у xL w @LE$ <$踖ÉE ]u}]Ëc1ɉ$EU D$L$‹%1ɉ$EU D$L$둍]Љ U ًEs]ЉU ًErU]Љ1U ًET7ɋ1҉$ET$U D$g T$PT$U $E?U pE$t$)U E$ gЉЉ&'U(]]uu }}S4;ssN k< F A[8EEFFtED$D$4$1]u}]Ë 'غkڍt& 'غN뽍F,F WV1t뤍A |t&UWVSEEP,҉UE&t[^_]Ðt&MU苁$P u؋M싱tE苐MA,EEq81ɀ;}r;PGHɉFHGFGLFLG@F@GDFDtY<ȉHكP9}wŋU1ǂ4@t8Mǁ|ǂ@ 'f[^_]ËEMQ,1ƁǁH4‹@,D$$GMA8(k< $D$FUB4M苓<A89rPXPFD$E$RHCFD$U$=HCFD$M $(HCFD$E$HCFD$U$GVȉCFCF̉C̋FCFCFC1tT$M $G9CPCP?E[^_] UuƉ]X +X1;VvT$4$^^ ]u]Ít&U(}}]utdG,E쀿t:U싂|u tO ']u}]Ë 'yf11҉ȋE$eESUB \$D$$PEP ډP k$dt t8uE<$Aغb؋u]}]É<$覀vD$ D$ D$F$蒕D$$$tcm1kt&US$Utlt\ƃED$D$D$E D$ D$D$D$$RЃ$[]ËD$D$D$D$D$ D$D$$W롉'USE]D$E $D$u$Ѓ[]ÐUVS ut[ƃED$D$D$ D$E D$D$$D$RЃ [^]D$D$D$D$D$ D$D$$X USE]D$E $D$u$Ѓ[]ÐUD$$ ZÍt&U=q8uZ=r8u$r8q8?'U1҉=q8tɉt8q8r83u|?t'?D$$ 蟐1ɉ|? D$ $t  t@f|?$  ES EL$D$$Cs Ee3uC0[^]ËB t 빐BuBuBu1܌&Uuu }U]D$\$B $rNjF\$<$D$蟊UB ]u}]Ðt&UWVS}u[^_]Ðt&k?E܍U9‰EUvtƐE$U }E% fEmm}]E E fEm]mE;t9uw)tUe3u|l[^_]ÍU$ }E% fEmm}]EME fEm]m]t&28uu1x~UD$$Ít&UD$D$$;.ÐUVS]5 8t<< &"ut8Ġ[^]fED$$zu֋Eh]D$HED$DED$@ED$/t ;s~~^tOED$$XmX/,{/U싵9Q9t /;D$D$$8\ D$D$84$ixx/9t z/8\=D$D$ $Tipx/]O}ot&UVS ueE1E $D$ً! t€u҃)t /tƄ /Ƅ \$4$Ue3u [^]%oUHEeU1҉]uE }D$$~t5D$$7Ue3P]u}]À/8t)t$lÍ=s19t$|$$nD$ \$$D$Xp D$/4$htp4$yp`ov*>D$2t$$Hmt&؀|/5+4$>VmfU(Euu eU1҉]}t$$T$$$'k=wI\$$iT$$=Ue3u%]u}]Ít&t$$l&UWVS<]eE1E $D$WD$D$$4\$$=8Džƅtb<$j|/)t,9s$9u8/u|t9T$$<tK! t€C҃+ 87.C/C}e3=D<[^_]É! t€t`ҋ)tZD$\$4$U]{/,-tt$D$ \$4$9, t&;D$D$4$Xc[US4?u؋$&Xu4?[]Í&'UWVS ]4?tqJ9vR1J9vG9sȉ֋u<{9s9r6<$yZt7xGBJB))ЉJ [^_]Éƾ4?1iS<1E t׉|$D$$$>1뻍v'UuEu ]D$4$tEt$$D$X؋u]]Í'U}}]u<$ XpE 4$D$tt$|$$W؋u]}]ÐUME ttBH]ÐH]Ðt&UM S]tABAt[]ËYt&UUut&ʋJɉB u]ÍU1Utt&Ru]Ít&U1WVS ]} uu[tt$C$ׅt [^_]ÐU]]uu D$$ tX]uuE ]]1u]ÍvUWVS ]} u.$t stC${$qu [^_]ÐUVSE=IsHIs3t@tD$HIt$$HPu͋[^]Ã1[^]É'UJd]HdJhHhJLHLJ\fH\J^fH^JTRXHTPXÍ'UEEH ]Ð&U]t?ÐUWVSE}UME 9׉EAd@UEE ES<< K< O0vU9UMUv9}vfEtUMBdL$|$$PE9EM19uFUǃ9}TUwUE+E U U [^_]<'<\<"F"E9Er!M\QE?EZ9EsߋM[^_]ËUBdT$M $P҉듺'댺nfrv\lt&H1.t&UWVSE}UME 9׉EAd@UEE EUtyUMBdL$|$$Pt\E9EM1ۍt&9uUFǍTU9}wUE+E U U [^_]'tE9Er,MEE9ErM'A'E맍M[^_]1뜍&UUM 9tRA$D$V UED$$Ðt&UWVSED$$UBDAD$$nUEBHrD13t!UB D8t3uF$F_F' F.F!F=F>F< F|F&F# F;F:F\F/F*F@F`F"!t&D1<< ЋUDuFX1FxFBFbFN Fn [^_]ËUBd\$$P;UB D83[^_]Ít&U]ÍE}׉uT$D$$t E=Ev]u}]Ít&|$$dEt׉|$D$$x-E|$ 4$D$ED$|$4$9]tE$냋ED$ D$E$4E$1W&UWVS]C3EC;C;EC B EUB E0CtD$$UBCtD$$}GCtD$$UB1CCCC,C [^_]Å}CtD$$*GoCtD$$UBJCtD$$}G%C t5D$D$$fUB C$t&D$D$$*}G$C(t&D$D$$UB(C,t&D$D$$}G,bC8t&D$D$$UB85CtD$$}GCEu_ ud 3E@ P,~@h T@d`S}GTGXExt8H8t1x t*H(t#x$ttxtH,EH EH tBa8BAs:BBsEH E$0IEH 4t&[^_]ÍvR1[^_]Í&K _&K D&D$$l%EtD$lD$E$H3E eEH u@hS}E=EH M@ t&t&'US$p?]t.D$D$$y\$$D$$[]$i CuD$z $i t*D$D$  D$7 D$i $D$D$ D$7 D$ i D$7 D$z $WU8}t&USE ]8u] D$$Q9x/t/@؃[]Ð&UEE UE ]?&US]t2C$跽C D$$][]&[]Ív'UWVS<EeU1҉D$$$i9|U $@T$D$ D$D$$聽D$D$ 4$8$ <$9t^X\$4$E DžD$$落uy<$89fu<$J:BBE unD$ 5 D$D$$]N$=Dž3<$<9$E DžUe3<[^_]D$`4$tD$`D$$.6\$$|6E $D$D$@aDž"<D$$$ D$ T$Dž"2Dž<9UWVSlEM UeE1Eƅ)čD$}u AEЍ1+uP 5E9U‰9EڋM+U؍4 =MME9s9+}\$<$~#ىu9w릋MË)9;R9Ue3Ze[^_]ÉE(UL$҉4$~L$$4$T$+t$<$t$$<$D$+$|$+|$4$t$$4$T$T$ $4$T$9UT$L$$3Uډ$L$y&t$$x9t[]+u9s+~})؅9q:Uٍ<9w]*uM)Ή+)؅D$$/T$ $x]T$ $]+uYJDu9w대>E9w`}9wu9w(u.u9wALVhTb tdSE󋍴<9w}9wu9wu9wE<9wE󋍸<9wu9wJu9wZE9w}9wK`/USU ]M]t"uڃCEÅu[]ÐUSU] Mtu[][]ÐUUu]BÐUMU t&t:t]1]ÐUWVS\} eE1E]E`=uE=ۋuC"1Eu(…‹UEt3MuUU(…‹UMufuGUe3u.\[^_]ÍC$"v1xi-ރZ- UWVS\UeE1] MxuEu(ȃ0҈Et+ѿgfffuȃ)kҍD0шuuUe3Cu\[^_]Åy-كz,UWVS]E Itvu+-Džd;0u?0ttDžh't&PЋh;U }8t3hA< vӍA<Pɋh;U |9UE1ЉыU)E1Љ)9&h?tDžpDžl9~t91} pU plput9pldxLU9l|^lE#Ĝ[^_]ÍvA<Pltll9E}#"1Ĝ[^_]ÉDžd"DždDžpDžl0 ?#!1v듐UEM 8t u]ÐUS];]s'=E fɉu ;u[]Ðt&U |$};}$] t$s,1ҋ D1t1 $t$|$]Ít&UW1VSEM ]UEEE؉UE;Mru;][^_]À};]rtj1u`J`IEEEu3`JE`IE:UvE҃[^_])‰Í&1Ҁ}ƒ[^_]1Ҁ}V[^_]Í&UWVS ] MEE}ȉEE}9rRuN}u999s&ڍO< t< A9u1 [^_]À};MrtmUEu`JU`IEEEu1`JE`IE:U:E [)Ɖ^_]Ív& [^_]<Xރ [^_];MA}˾'UWVu S]9r ~9sw{ tEUȃ?`I‰ЋU1ȉE88`Jt'Eҋȃ?‰ЋU1ȉE9r[^_]É'UMU }}uu]:99sIu]u}]Ít&`I`Jt 9v99wt)Ӊ\$D$ $!럐UME ]]uu)9؉}}s2D$؉T$$2]]} }uu]#D$T$$F&UVuSMU t1ۃ9u[^]ÐUWVSE}eU1ҋU EEUEG"E Eu*U0BUe31Č[^_]Ã}EU}EUEUD$ET$ U$T$mEEUeUE)`=UEEUw=wut-mlj(…‹U`=ufUUEUuЃG$"v&t&1}fEE{xU-]U]U#fUWVS|UeE1EM }UMM Mu"0GGMe3 |[^_]Ã}EUUt&EUD$ D$ $T$N mEEUUE)`=MUUMwwMt7gffffm)kȋM`=uԍt&UUuG},EE됅-]U]@"UWVS|EUue=}1EE UE1E}Љ}E%E9E}}%uփ1>-*#I1Et.1E|PЅuEu܀>.~E>l_}9}t%U}}Uz )EU+EUTË}+]}<$߃0\$D$}i'U(EED$ ED$E D$E$ÐUWVS,u] }~TuBt&}w+ËFdU|$ \$T$4$P ܃,[^_]Ã,[^_]9s;؉y v8x܃9ut&&'UE]@ %Ðt&UUSJXt1zTu1[]ËZ8tf{u卶UEP8t1fuu׃1[^_]B8[^_])Í'US];]s)E@8 PE fɉu ;u[]ÍvUWVS};}u s(EP.uF9t~0u)T 80uσ9u)fč&'UE+E ]Ðt&UE+E ]Ðt&UE]Ð&UEUM+U 9v]ÐUU E9r 9s x t&t])Ív'UWVSE9E=uU MM+UMB9E EMu x,UEE E)EEM9MuVMU8 uߋE9Et>M1FQ:t#뼉؃T0U؋ULU:u;]uڋM tzMU E EAA} v\A EUAB+A B[^_]Ë] tE@@[^_]Ã1[^_]ø獶'US] M+u QC)[] UVuS^,t*F^1 &8vfV^u[1^]ÐUWVSLE E9E EdM   1-EfẼM 9(M ;M9M E 0 1 0 wҍ9ύBu9}EЋẺ+M EEM؉EčvqЉ o}ԙ1EЋU5򙙙 _EEEEȅc]);}=0< /Mĉ 0< w9uM؉ׅE MU!EEEЋUԃL[^_]À+M M ;M:U:M܅rUMЃ"EE뛋M[M ֋ŨU D9l t t1-E].uuȅ}9}a]ȅ]E)M؅;}sD$T$<$9v)؍D$D$ $]u}]É뾉'UE]]u}EE9vËu 9ۉً}(…u }t+E]u}]Ë]鐍t&UE]]u}EE9vËu 9ۉً}(…u }t+E]u}]Ë]鐍t&UE]듍vUU EUE ]t&'U}U} ]]uu9t9w>D$T$<$9v)؍D$D$$@]u}]É뾐UWVS EUEtoE_v E_<]wIE_v E_<]w#E8EuwE8EunzKzKX:Xu&˃bEE1ۃ [^_]GXAX )É[^_]]EU E )붐&Uuu}}E]9EvUٍE u }t)]u}]Ít&獶UWVS}]9vލUE \EuE9tA9EwGM )9s*Ή< t =U < u3D9uvEEE[^_]ËEEE <w]E[^_]ÍUWVSEU] }$EEUދUM(E݋E ډUU;]ErX9E 1E}ESU9t{B_ECAUB9]UuqE)}]0U,9}tU1)t& 8 9u1[^_]f:Ut`:U:UE]E9]tU9Utm2xvKwAE9EsU]]qEE]WtUuU뢋UE B tE)],U E0U1+U]9uUM U_w]Àvu]1ÍUE ]_v vt t&뮋E+U [^_]Ít&'UWVSu E}EEEm}t&;uEC_v A_<]f@ »[fv"[fv 6fwsB9uvmW׃m}\E9EvE+ED$ 4$D$E[^_]ÍWX믍[f*6fy_[f\x6fh[f=g6fGW Zf= VU6f=FYf=E5f=V5f` =Wf=O4f=+fYfTf=v#2f=fZDRf=~8/f=n]fOROf=?+f=/fo=Lf=_'f=_Of]5f_*fff=If=O#f=>fTFf=Hf=rfaX Df=Hf= 8f^ffYAf=~ f=vr?f=v Gf=wiuT=f=v If=3wO}<f=v f=w_V;f=v  f=wU/);f=v @ f=w:f\v * f=wk8:f(v 0f=w:fcv [fHw9fv f|wUl9fv f6weE9f v ^fwl9fv Ff wv9fv 9fwyf}t 4fw}ff~ffft&fSfFf9@* Eèöó~UWVSD}t E9E}u EE))E+E 9EuЉ}ԉU}uEtE]Ѓ}E]tu u+U;U}(E܋4,7 +U;U|؃}EtE}}EE+EUȅu+E 9ERE؋,7 EUuȍ&<]+U9U~wA<um]ˉf[<u 9]σ};U|r+E;E}?+E܉E܋Eԉ}ԉNjE+E,D[^_]É<]t3u;yf}똍F+M 9MEFUĀ<]U[uĀ<u 9]U} 9MXE+E 9E} U+E؉E؋EЉUЉE}E9E]@7 ]+E 9E~F1ɉE:t;E9E~1:u-EuUu؋D7 0sEE}(uEEUu4@7 uU9U~O:uK19E~=]:u3]7Uu݋uU܋MD7 ELE}(uE6UEV(}뮋UtUWVSuEU }]EUt'Ѓ|2 uV  < u V҉ut&| GS t< u S҉uEUE]}uE U[^_]t&UWVSu EU](EEUU$}U E9U9U$:U8‹M$:U 4 t<v+t'9t;Mt:Ut :Uut&E@ t9U,+E$E0U 9MtU1) 99u1[^_]ËU E,ǍF9lbM$뚍v'UWVS,uE)u؉+E;EuEE|R}EtE}UEtU]9]s E܋M ]M܃Et;։+E;E}EV<,7 t<Ut=V륋E9EsU +EUD$ D$$ME,[^_]ÍV+M9MF<u؉ v<u 9uڃ} 9M+E9E:}+EEEUEM @7 M +E9E~G1҉:t=9E~5: t&u-E uߋUsMD7 EE}(uE}fQ#뱐US] U A<vA <w')ڃ~ SB<>w[]Äy t&v[1]É'UU B<vB <v]f]Í&U$EE}]uU0E < E9sE;us@E|$\$$=uD@g@g8um9r&E1҉E0]Ћu}]ËEt$D$E$tKV  9u[))щ렍t&UEuuU ]]}}$E|$t9wu)]u}]Ív䍶UWVS EuU ] EED$E$Eu;f9] tJM 9s'Ή< t $U < uD9u1 [^_]<w߃ [^_]ËUEU9t׉ӿE 띍'UWVSEUM}$EE Eu(]$} UME9E9E su-M0+E$҉M,t  9w1[^_]ËUM ET$L$$u2U :Etc:E:EU U1U 9߉UvM AMMM 79UUvMET$L$$stU BU9sMME E놋U,+E$E M09w&'_U>w]Í~=~v#x\v(aw=]w%@ ]Ð]Í]Í=d v=wL]8]Í= w `P]Á@1 Uc]ÍvUM;MU s5~8B=w>8 tI_>vQ]Í]Í&o=w : ]1Í=cv=owD ; 끍=w G g=w I M=Fw L 3j=) w   =Ww @ = w  =! 'U $]t$u|$} 9s!~*_>w($ȋt$|$]ùC9rCHɃ뽉'UU VuS19r "9v A_<>vy9w[^]Ðt&UEW}VS]U t)9s% yA<v#A <vA_<>vՋE+U [^_]f)Ѓ~rF<>v yv렐t&UU _]vt1]DÐt&]É'U]]uu }}ۉt ;urW&)]u}]ÉU;UsYtDtV-]fw=E->wM M f҉t=M ]w\`U uͻ~tveM w2 U ۃ]w 뗍w"LJw"jw"`딍Rw%= w%dUw%@ w%47w%/w%Pw%Vw%@w%@}Vw%]w%M]w%t]w%@]w%D]w%]w%@]w%]w%]w%]w%]w%@]]w%]w%-]w%@T]w%]w%$]w%]w%]w%@]w%]w%m]w%@]w%=]w%d]w% ]w%4]w%@]w%]w%]w%@]w%}]w%߿]w%M߿]w%t߾]w%@߾]w%D߽]w%߽]w%@߼]w%߼]w%߻]w%߻]w%ߺ]w%@]ߺ]w%߹]w%-߹]w%@T߸]w%߸]w%$߷]w%߷]w%߶]w%@߶]w%ߵ]w%mߵ]w%@ߴ]w%=ߴ]w%d߳]w% ߳]w%4߲]w%@߲]w%߱]w%߱]w%@߰2w%}߰]w%߯]w%@M߯]w%t߮]w%߮]w%D߭]w%߭]w%@߬]w%߬]w%߫]w%@߫]w%ߪ]w%]ߪ]w%ߩ]w%-ߩ]w%@Tߨ]w%ߨ]w%$ߧ]w%@ߧ]w%ߦ]w%ߦ]w%ߥ]w%mߥ]w%@ߤ]w%=ߤ]w%dߣ]w%@ ߣ]w%4ߢ]w%ߢ]w%ߡ]w%ߡ]w%@ߠ]w%}ߠ]w%ߟ]w%@Mߟ]w%tߞ]w%ߞ]w%Dߝ]w%ߝ]w%@ ߜ]w%ߜ]w% ߛ]w%@ߛ]w% ߚ]w%]ߚ]w% ߙ]w%-ߙ]w%@ Tߘ]w%ߘ]w% $ߗ]w%@ߗ]w% ߖ]w%ߖ]w%ߕ]w%mߕ]w%@ߔ]w%=ߔ]w%dߓ]w%@ ߓ]w%4ߒ]w%ߒBw%ߑ]w% w%ߐ]w$}-!t]w%@ߏ]w @NU *ߎ]w #ߍ]w  ߌ]w ߋw <-!-[w `E fU t$u|$}$] 9s~^ h>_=@  T1$t$|$]ø荴&_!tR`tHo8PhA3w7 Y~"F9€V]9+t*9w}  `hrtF9€FVF9~Ⱥ]ALBk^F)эAF| w%N +w%i:V$wn Rwnj FS@9LjrmVLF9rVȺ]ALBk^)эAF w/  w/.j w%  w6FjW"!o"~ wG ^pwZjj.w'bj=w%  =w'jҰ=8w%`w'k=w%~w%4k^֪=w'nTD=mw'` |=w't =w'@{=Qw'@v=w'hw=$w'=w'n,v=w'`ދ=#w%:slw'R=?w%Gsbw' ʀ="w'`r=w'|='w'cp=w's=w% njnw'r=w'V< !E9t 9Mut&E@ tKU,+E$E0U 9MtU1) 9uE [^_]Ír9udU E,뵋M$E떍UWVSuE)uEET}]uEtEE9Ew ME E+E9E~MuuEE +E9E~J:uFEى9E~6:u,QuUu_U<sR1NE}(ut[$ȋt$]Áv0Ɂwݰ9s)ȉljЃ?ȀCЃ?ȀC롍v'USvwЃ?ȀA[]0ہwл?ȀAƍ&'UWVS,] E؉E؋EEE܋E@@E1;]squDUE΋ t @AE܉Ut$T$D$ E$~,9]v#E؉\$D$ ED$E$+E,[^_]Ív'UWVS,} E@@u9Er9~ t]MNjt Í@\BEӉ]ȃ?E؋EE؉U1ʋMUU ʃ?Љ1ȋME}9s+MUt$ |$T$ $E\,[^_]Ð&UWVSEu @@E1>tS] 4UE΋ t @AEU~ƀ;tEٍU,+E [^_]ÍUWVS,] E؉E؋EEE܋E@@E1;]sruEUE΋ t @TAE܉Ut$T$D$ E$f~,9]v#E؉\$D$ ED$E$+E,[^_]É'UWVSEu @@E1>tT] 5UE΋ t @TAEU~ƀ;tEٍU+E [^_]Ðt&U(UB@$D$ E$D$E D$ED$ED$ED$ ED$E D$Ðt&UU ]TÉ'UWVS4] E}؉EԃE؋EE܋E;]؋@@Er:\UE4t@TFU S9]v;}ЋE܉|$D$ ED$E$E9]vC ;]r9]vE4[^_]Ð&U ED$ E D$ED$E$ɉ1!É'UU vvv w]]1Í&'UWVS,Eu ]@@E;xE@ŠExx@ŠEUE9t)ƒ,[^_]ÍFD$ ED$Et$$UE΋ t @TAUyCD$ ED$E\$$p~0UE΋ t @TAUTS\$4$"B\$4$/t&UWVS@] Euuߋ@@}9Es 9uv+E)9t8sB]9s(ٍW< t"f< B9u1@[^_]þMEՋt @LBUMƉUċUԉEȋ҉UtEč@ETPU;M]̋UU9߉MB;u9UT$|$ \$E$E̍Et$ UD$T$U$M̅ɉE~E+u)߉}9u~}9(u+u<ރ@[^_]v UP]E] Uu}}EˉދR@u}9U9}UEt$ \$D$$UT$|$ E̋ED$E$U̅҉EMEՋt @LBUMƉUUԉEċ҉UtE@ETPU;Muv]̋UU9v;}w\f}tE)]u}]ËU))+})މu9}~}9(…uE+E뱉M9Ms또UUB;EwBЋU ]ÍvUUS] B;EwعZ[]Ðt&UWVS$] E<E9@@Er@^UE΋ t @AEU|$ \$T$${9u&9v ED$E|$ \$$'E$[^_]ÍUWVS,E} @@uEG9w~9~ t9MUt$ |$T$ $E]MNjt Í@\BEӉ]ȃ?E؋EE؉U1ʋMUU ʃ?Љ1ȋME}9X,[^_]U1]É'UWVS$] E<E9@@ErA_UE΋ t @TAEU|$ \$T$$9u&9v ED$E|$ \$$E$[^_]Ðt&U1]É'UDuUu]E] M}Eω߉U܋I@}9M9UE|$ \$D$$UM܉t$$L$ EԍED$Uԅ҉EMMŋMtEЍ@DBEЋEЋMEEՋt @LB9Mu[]u9v 9uwA&}t+U܋]Ћu}]Í+}܍7)፶)ыUЉU ;Mкs뵍v'UWVSEU@@UUEE9‰EvEM] uu:C@|AE tGF@TA9uDmtNE uC<E u&F9t9}A[^_]ËU9Ut*r2M M;u{ Su#9r1[^_]ËEU :wݍULE̋E}]Ӊu΍<ȉE؋E9@@Es;Mr}+}؍7)ڋ]Ћu}]ÍMEՋt @LBUMƉUċU܉Eȋ҉UtEč@ETPU;Muk]u9v9uvME̍UT$|$ \$$&U؉t$T$ ỦEЍED$$UЅ҉E~T)2+U('UH]E] uUu}<E9U܋@@E9։Esz}U܍Et$D$T$ U$sExLUE΋ t @TAUT$U|$ \$$gxu9E9uwv}tU)ߋBdD$ |$\$$PDE]u}]ÍU]ÍU]ÍUWVS<] EU}؉EEU܋Gd\$<$T$ UT$P E+  1u1]EỦEЋU܋Gd\$<$T$ UT$P UÍBЃ vmBwUBɉEU9U~b&;uEƍ4똃-vp1}E&BwBt&EU9UEtE9]EԅuF}؅tFE"]Ըu<[^_]9U^Ew}؅uMԉtuEtEU1T<[^_]ËU1!<[^_]ËEtEU3!<1[^_]ËU"Z UWVS<] EU}؉EEU܋Gd\$<$T$ UT$P YE+  1u1]EỦEЋU܋Gd\$<$T$ UT$P UÍBЃ v]BwGBɉEU9U~R&;u|tuEƍ4뜃-w1}EBwBvEU9U}tE9]tVM؅E"<[^_]Ív9UsE!uEtEU1T<[^_]ËU1!<[^_]ËEtEU3!<1[^_]ËUԉtzt&UWVS\E UEEEEMU؋AdT$ MԍUT$L$M $P |E+  M1]M܉\$t$ $D$a.EȉỦ\$1ۉt$ 1$D$k/EEЋEEUvUM؋BdL$ UԍML$T$U$P cUEԍBЃ veBwMBɉE}9}~Z;uw ;]ȐEv뎃-1}EUBwBt&E}9}EtMԋU E9EEA}ąM1"]u \[^_]ÍvŰE11 t2MUE1ӉMʉEU]ut&9}sɋ]ȋuxt&c&^Nt&Et&tMԋU E1T\1[^_]ËM؉7؃+U1!\1[^_]ËEtMԋEU3!\1[1^_]ËE"&UWVS\E UEEEEMU؋AdT$ MԍUT$L$M $P E+  M11]M܉t$ \$$D$O+EȉỦt$ 1\$$D$[,EEЋEEUvUM؋BdL$ UԍML$T$U$P UEԍBЃ veBwMBɉE]9]~Z;}w ;uȐEv뎃-1}EUBwBt&E]9]UtMԋU E9EEąM"\[^_]ËŰE11 t2MUE1։MʉEUu}t&9]sɋuȋ}&eMtMԋU E11T\[^_]ËU11!\[^_]Ë]tMԋEU131!\[^_]ËE#ރvUWVSlEuU MEeE1U1E(ȃ0҈EMt/׻gfffMfU)kҍD0׈u݅t-}}9}sktd]9v*FtUJd|$ \$D$$Q$Љ+EUe3u l[^_]Å7پ-1t&UWVSEU }e M1ɉEEUUEU[1U UE}'UUvEUD$ D$ $T$' mEEUUE)ʉу0MUUMwwMt9gffft&m)kҍD0Mu EE0Et mE-}}9}Uu9v*CtMQd|$ t$D$ $R$Љ+EUe3uCČ[^_]Á}MM*]U]19t&UWVSʉ)ډ$`#ƋEȉ1׋U EЉكMȸʚ;EMEUEUEЋM]1 T1M6u̍Ƹ eƋE׉EЉ{wr t&w `E1ɻ"I9uM9uԍGGA]؃]؃ZUfB]B\]؈fB_]؈B^A(sv&U1}M t]ËU9s39vu+y t!t&8ux &u9w])]1 U}E} ]uuE<$w4$ww9s؉EE]u}]"fU}E} ]uuE<$1w4$'w9s؉EE]u}]fU(E$D$ D$E D$ED$ED$ED$ ED$E D$E$6Ít&U(UB@$D$ E$D$E D$ED$ED$ED$ ED$E D$Ðt&U(}E} ]]uu9t9wM\$D$<$v9s&UBd)ډT$T$UD$ $PD]u}]Ít&믍UWVSLE ]eU1҉EEuE܉EEE1u!;utzFMЃtaMЀ%uڍvB< v.t-tlsduAut<;utF%Mu+EUe3L[^_]ËE)v։QUЋED$D$$'I}8MAʃF:uAỦEЋ9)Utt<$tE9Ew mċEăEȋEȅMȉBuUȍ4VED$ D$${HO uv'UWVS<E e]1ۋUM}ËE=vƉBdw.˃GdL$\$<$T$ P ċ+T$D$E\$t$<$D$ t + K Me3 u <[^_]t UWVS<E U}EeU1҉E=vƉvBdw.˃Gd\$<$T$ T$P ċ0D$$T$+Ee3u <[^_]sUM U_vE<~t&E<}CKE@<>vIE<~v>v`T:`TuWmEE 1҉[^_]EM} E 9u5zK뱍zKG`TA`T[^_])‰)뇍Uuu}}E]9EvED$E \$$u }t)]u}]É덴&UWVS}]9vލED$E t$$3EuD9t@9EwFM )9s)Ή< tv}EvTCw]ÍBvCvB<~wjfU Zf9uvK˃uE9EvE+ED$ 4$D$dE<[^_]ÍK`T뵐US] U A<vA <w')ڃ~ SB<>w[]Äy t&v[1]É'UU B<vB <v]f]Í&U$EE}]uU0E < E9sE;us@E|$\$$=uD@Z@Z8um9r&E1҉E0]Ћu}]ËEt$D$E$tKV  9u[))щ렍t&UEuuU ]]}}$E|$t9wu)]u}]Ív䍶UWVS EuU ] EED$E$Eu;f9] tJM 9s'Ή< t $U < uD9u1 [^_]<w߃ [^_]ËUEU9t׉ӿE 띍'UWVS$EU} u$EEUދU](E݋E UU;}EJXs9r51U0U,9utU1)f 0 9u$1[^_]ËE 1EtuUE|$T$$tNU9UUvU;}sE9EsmuE)uT:Et:Ety:EU봍W9UUvߋET$UD$$]tGUU}E9EsUU}UZEE@UE B tE)U,U E0EE9Ewf_U>w`]Í~=~v'aw=]v&@1d w]]f]ÍU$]t$uM 9s\tr $Ћt$]ÍvA=w6 tA_>vȍC9rÉȺKfo=w`1땹_뿍=v=ow 낍=w h=Fw Nj=) w  4=ht&U $]t$u|$} 9s!~*_>w($ȋt$|$]ùC9rCɃ뽉'UU VuS19r "9v A_<>vy9w[^]Ðt&UEW}VS]U t)9s% yA<v#A <vA_<>vՋE+U [^_]f)Ѓ~rF<>v yv렐t&UU _]vt1]DÐt&]É'U]]uu }}ۉt ;urW&)]u}]ÉU;UsStDtV-]fw=E->wM `]M f҉t=M ]w\`%U uͻ~tveM w2`_U ۃ]w &뗍w"_Jw"&jw"_딍Rw%'= w%_dUw%@( w%_47w%)/w% `Pw%)Vw%`w%@*}Vw%@a]w%*M]w%bt]w%@+]w%bD]w%,]w%c]w%,]w%@d]w%-]w%e]w%@.]]w%e]w%/-]w%fT]w%/]w%@g$]w%0]w%h]w%@1]w%h]w%2m]w%i]w%2=]w%@jd]w%3 ]w%k4]w%@4]w%k]w%5]w%l]w%5}]w%@m߿]w%6M߿]w%nt߾]w%@7߾]w%nD߽]w%8߽]w%o߼]w%8߼]w%@p߻]w%9߻]w%qߺ]w%@:]ߺ]w%q߹]w%;-߹]w%rT߸]w%;߸]w%@s$߷]w%<߷]w%t߶]w%@=߶]w%tߵ]w%>mߵ]w%uߴ]w%>=ߴ]w%@vd߳]w%? ߳]w%w4߲]w%@@߲]w%w߱]w%A߱]w%x߰2w%A}߰]w%@y߯]w%@BM߯]w%zt߮]w%C߮]w%zD߭]w%C߭]w%{߬]w%D߬]w%@|߫]w%@E߫]w%}ߪ]w%F]ߪ]w%}ߩ]w%F-ߩ]w%~Tߨ]w%Gߨ]w%@$ߧ]w%@Hߧ]w%ߦ]w%Iߦ]w%ߥ]w%Imߥ]w%ߤ]w%J=ߤ]w%@dߣ]w%@K ߣ]w%4ߢ]w%Lߢ]w%ߡ]w%Lߡ]w%ߠ]w%M}ߠ]w%@ߟ]w%@NMߟ]w%tߞ]w%Oߞ]w%Dߝ]w%Oߝ]w%ߜ]w%Pߜ]w%@ߛ]w%@Qߛ]w%ߚ]w%R]ߚ]w%ߙ]w%R-ߙ]w%Tߘ]w%Sߘ]w%@$ߗ]w%@Tߗ]w%ߖ]w%Uߖ]w%ߕ]w%Umߕ]w%ߔ]w%V=ߔ]w%@dߓ]w%@W ߓ]w%4ߒ]w$X-!mBw%ߑ]w XU ߐ]w Yߏ]w @Zkߎ]w [Sߍ]w [;ߌ]w \#-!tw <] E v'U t$u|$}$] 9^>> ~_= T1v$t$|$]Ð獴&_!t:`t0o8P%~"F9E€Vt\F9FS3v:9+9|F9Ⱥ]ALBk^F)эAF~S+w)@3| _!n!+!fr"pC@?F9€FVV$wR@F9rȺ]ALBk^)эAF.w%@ w%p=w% w%@w/@ w/Œ7~w't=wD"]"[#^MKwAUҰ=8w  =w%i`/w%  ֪ƉuEEt.ut'M9MwWs5M֋}9u[MUJ U19U]u}]ËM֋}9(׍t&}ɉ9u US뼸fUWVS.tI9fr>.t;)uv$D$ u݃ [^_]Í&'UWVSEU싰 9rE9$D$9 uՋE0U}싂G E苚)؃މu~9]w#E9 ޿u؋UC}U싇BC[^_]ËU:} BE[^_]3$‰D$^t9}CUB[^_]޿ve<"tY<'t&tP9]w2&E9 v$D$tՋUЉZID}S9 voEC:u%E:t}9 wE}WE:t}SSBUۋ}뾍t&UWVS,]E E ; sa:D$ 'D${U؋M)uU؋M)F,[^_]11҉tfISt&D$ D$$D$D$",[^_]ÍU`IU؋M)`U6U%EEXU؋M)U؋M)11҉UaUEED$ \D$D$ D$D$ <D$UWVSLE UE 9‰E< < 9-E9+6EE E\/+E<00< GQA }9v9t1щ0< v0< 9ٍ4Bu9}MW U9щMvU]E]v0< )]܃;MPUuۋE9EM0< {]M9EP0 M 9؉t]C0< I9u@;uҍ$V$>]u}]D$$ E뱋E$ D$뭍t&'UVS ute4$dž|ƆD$D$D$D$D$ D$D$4$P4$;$$&u=9t$Kt 4$P,u< [^]Ðt&9t$9މuƆ떍vu [^]钀fU(]]u}Eu~1t $Zƍxu{$1'\$T$D$]u}]ÍD$$ Eft&E$ D$m{?uvqGW\t&#u GD$UD$$W F=w$D$CUT$$<ա'D$$D$ UH]]u}S t%CPSHC]Ћu}]1Ҁ{LuCEЃ|KD{UЉM܋C<$E  MЋQ:U‹EUԅK1E=ME)9E܉ UE؅tUM;uME$VuU1CH vBBCLMЍCM9ǁ|tl1C'{MT$UD$$b뭋MЋQȍM܉ ESDSSHjǁ눡'UD$D$$K1ҸE륍&'UWVS(D$D$$*TlEEEEfE $E䋍TUEffE⋁D$T$$D$ TDž\|5&D$ t$$f'TD$D$$!?\6Tǁ\lD$D$D$ D$<$hD$ P vT$@D$E$}TLJ\'D$U$` D$lD$ ; DžlTǁ|JCx<$NFxXT$<$)ЉD$6<u<$*:>qD$ȦD$|<TD$D$ '<$D$gBDžDžDžDžDžfDžƅx<@|DnH`TT]Uf`$D$@D$f`D$$XhDž`7d p$T$L$`T$ .E$ t T@8``TT$ $T\D$JD$CTǀ\'D$TU$|$ D$D$;D$TU$'^v1E E`UEEEU[^_]Ã~ wɃwă~ w;w;t&wUE4$T$ U UD$D$uf}?wTv}d&h}6|} iM@B@Be@圍0EUq| }wE@圁U0t&J}Į }t&|}&iM@B@Be0@ȍGEUEEE}䖘s}F|}迾&E@BiM@BʉEU}?#-v'U(UBD$$BD$ B D$BD$BD$D$ :D$D$D$E $É'U(UBD$BD$D$ XD$D$D$E $Í&'UVS ExXHP tAE \$t$L$T$D$ gD$D$$R [^]Í&븉'UUM B w$xt&]1ÉM U]]M U]M U]t&UWVS|UE M̋Z]ЋruԋB E؋BE܋BEBEBEB E썁OE}EEԉD$EЉD$Ẻ$?MU- iQiEkE<E‰UEL$$裿Eu؋}9U܋]MԸ+M|+U)M+]kMU] }u]u]rUE]@  ÍUE]4Ðt&UE]@0Ðt&UE]ÍU(E} ED$EE҉D$ ET$D$$Ív'U1(MEU y0t-u0ED$D$ D$ D$$諺Ðt&EǍ&U8uu]]ED$\$ D$D$$Ut]u]ED$\$ D$D$$u]u]ÍvU(EfEfEEiE D$D$E$ܸ~EɃÐt&É'UEU xu@$]]fU(]]uu }}{t)127.1F0.0.fF1f]Ћu}]ÍS ET$ED$$.uɉt$C$$:1C"ff뫍vUuu]1ۋF0t,D$$*Ӊ$Y F0]u]ÍvUɃ ƒ ЃUٯ t1҃tɉÍvɺÍ&U詯ÐUVS]UM C  xIɋs t3C C 9t3D$D$$t![^]fC C 9u̓1[^]És ڍvUEE]鳱 U]]uu }}]]u u}E]eU(]E ]}}uESXC\9rmHD$@CT$D$|~9lj|bCTT$D$E$~]u}]ËE}u]}]E ].)Љ9,t$T$E$7sX봋CTsTs\CX늉АUE1} ]ÍUWVS,}u]ED$ |$t$$u,[^_]Ít&'UWVSÃ,E$D$D$$脴tz$6$|$$$D$$U~v$v/4$D$D$ D$D$1,[^_]Í&1 ED$E4$D$",[^_]Ðt&$5 UEU MEk]&UEU METs]&Uuu]tD$$軳$裴u]u]&'US]tB{0t,t$nǃ][]v$hʍ[]Ív'UEE]ϲt&'UEE]UWVS,}u]ED$ |$t$${u,[^_]Ít&'UWVS˃=?E=?hD$$r6E8EE$GUGU tU $T$褱E\$D$$tVD$|$$MaD$U$T$蛰$[?1҅tSD$D$@$)ڮCD$D$$)軮S҉C  T$ D$D$$$-E[^_]?6?pd&$蚲$s4$4EE[^_]Ðt&ED$ȧD$ 8D$$@ 8$량}t& 8D$AD$$D$  8$Ҭ[$1313U$躲E$3E E$3E|$ D$1fUSXMU D$ED$E$EtRD$ D$D$*$QD$@ D$$D$\$$葬؃[]Ðt&U(]] uu}eE1$s$D$|$$t!{\t9Ue3uL]u}]É$j$貰˃{\fuNjC`$)D$|$$蕨v'U]uu}}躧U 4$D$ED$Et D$@ D$$軨؋u]}]ÐUEU P,tT$D$$Ít&UEU P(tT$D$$Ít&UWVS,U$PtME`y8APdu E}9thE9tYE)D$t$$Rl݋U$uRtNU$PdtMƁ`ƁhEx8}E@P19,[^_]À}t$tE܋UM܃;J0<E뎃U܋UML$D$$Pp(M$t EU;P0rMƁ`ƁhEEx8UU $0}JMUT$U$T$Pp+ED$$/XU E$T$D$mED$ED$$*<#EEFEFEFEEFEFMA$FA$Eu EE@PEE'UWVSMx8t xF ^);];Ft:\$|$$苨FV 4$D$)T$,uqF߉F )]~8tw}vn])iU;]t%D$|$4$t׃[^_]É]&U;Vw:F U|$$T$ƧEF [1^_]ËX+X @ |$4$T$N[^_]Í&'U1ɉS]SC 9t)ЉT$D$$S1ɉS {8tC$C []Í&UWVS,EU}uEeE1EUԍTE ӈEӍŰE̺ME)}E)iỦUEUEEF EF M܉usU؉ucMUuRU1U;]EEu]]]]F UEF 4tUe3uA,[^_]Åu#MUu҉4$ZŋU؉u蝧'US]C$+C[]Í&'UWVSueE1U MӉωӍ))ЍE#ډ,u<;]tDEEUEF EF tUe3uQ[^_]ÉEUUEF EF uډIt&UVS ]uffED$D$E4$蟦t)|'Et!CD$C$D$Rhƃ`CC$C C [^]fU]]E u9Cw)ƃ`ƃhǃ\]u]fFD$D$C$tC CC1s]u]ðƃ`ƃhǃ\ UWVSÃU uMB Y0MD$BD$E$y6u$MAA D$E$6GY USE ]Uu []ÍvD$$a]E []uUWVS,E PUM15I EME}M:Mt~0:2u u;uG uȐP tEuMt/}1,[^_]À9uEu̓E}f‹MEtՋE8#u͉$skx#uD$ D$ D$E$ ExU ;sEuM UAD$M $E`,G[^_]Ã}t EEtU1ɉVS E uut#UBЋXRuEE $D$t3E ut)ِt&UBEBEBuރ [^]ÐU(]T$uƉ}eE1$)\$4$D$}3tD$|$$71҉ЋUe3u ]u}]蒘&'UD$uƉ]}$1u1ۉ؋u]}]@:@@ @@@Ǹ@=t ‰ى$Et ‰ىljٺPىEUHE&'UWVSL}eE1DžDž<$2Dž)8t $Шg<$+.t8(8<$D$$>Ee3CL[^_]Ë?D$D$$;3 ޅ&CD$D$ Z |$$D$*g(8D$$GCt=8u ?tD$D$$o-~u.뀋F^D$$8.h(8D$4D$$D$ 趕fUVSEu $ (8D$D$$PD$ 蹔t3(8$ D$輕(8D$$&uϡ?uDH(8$ D$(8D$$(8D$?$ӍuEp[^] &U(EMP@EBEBEB EBEBEBEBD$ $E, UVS ]uD$CD$E $1҅u [^]É4$eD$$`-tEED$C$Gt [^]Ðt&t$E$% 1[^]ÍUE]uu}UE1҃} ~-9t)Ut1EtOEtm؉ډÃ)ދ}]u]D$SG$dtGUCD$dG$dtGUCD${G$XdxGUCg'UWVS5I\t 0u$ϐTt&BJ0u9v [^_]ËE 1ۉ|$ D$D$D$ED$ 8$sÍ'UWV1Sˁ4} dE`eU1҅ɉ\t $$Ɖ<$1ҍ=h#D$\$ $(;~\D$ |$$T$=bD$D$ D$D$$.D$D$ $CS{%=,D$D$$/h9DžlƅshD$$D$茌`Iltu#t;tt![s11&'#"#v1uD$=4$2lj|\| IBtfu|G_tu$` I@tt&u9Ӊs<"u<'m)||fDž--ƅt$T$$9=Hua9tU\uG9tXsXB_l$L$ѺSET$`$D$dS9:GuD$UED$$|0u <[^_]ËED$ 8D$D$$ށ 8D$2D$$DD$ Ɇ$mE$np?1tPt&?t4D$UED$$o[K-9ftEU$Ey:$ ?$ME܋E@ED$$EU1Nt&MUt$$D$qE܍3$D$?D$SM9vbMU؋A$SM܋UƍDD$$E{LU1ɋE$U*UM؉JE?&'UWVSE$ED$D$!E?tvU~}p\} EEج}܋7t1ɋBuMԍED$ \$D$$t1 8D$2D$$DD$ $讇Eԋ}EED$ED$ EU]U]]D$ED$ |$$UEE$$D$Eb 1E}G Eă$}<$D$ED$0UE)]p18]Eċ} T$$L$Ɂ}EċUE]E}EGEGEG EGEGEGEGE$\D$x$D$~];~/}D$ƨ$D$}E9$'$ۅ&$D$E$ Up A ];Y}DE9wU*]3EEAEAEA EAEAEAEAEEČ[^_]ËUC]Z-Y{U1(uu}} ]u]u}]ÍD$$0øtҋt$$D$ ED$萄u(D$E\$$$1뒐t&${&'UQ(uu ]}}kx D$$t)|$$D$ ED$zu!9s؋u]}]$1߉'Uuu }}]>1w1]u}]ÐE|$t$$-t'\$D$E$f~$1븍1?먐U1҉MAtAA] Uuu]Ft*t29^tD$F$D$^]u]Ít&ʍUS]C;CtƒSC[]D$PC CD$$1҅tՉC CC뺐&USU] BJ BR)؉ $ʉT$D$[]fUS]t$HCC[]Í&'USMU] 9QwAE ]E[]{z&AE]U []|&UVSE]u Mu1fr[wFt4KCC sD$ $1҅t1[^]Éȍt& 9v빐t&vt&C[^]Í&'US]C;Ct.ƒSCC$D$E D${1[]f$¸ut&'Uuu]]}9^w1;^sVNڋF)D$T$$xCFFD$E $D${1]u}]ËN D$P 1FD$$¸t~hUSE] $Ov]E []xU(ED$ED$ED$ ED$E D$E$`}#EÐUM SU]tu[]ÐUWVS\E MU09v'=Iʉt& tM9uEU $]vEuEt\[^_]؋]K1-Et!B9t؉90u19u땀+uMȬtoGdWX\$<$T$Pu"t:t[^_]ËGd<$T$PދM: ũ:뿍vUW1VS ] u9s(UBd$t$\$PtӃ9w؃ [^_]É'Uuu]]}t} 9r-} tO+] C]u}]Ð׃t-9v֋UBd$\$|$Pu׃uӉ+E 밍&'UWVS,uE}1t=] Ãt9UGd\$<$T$ UT$P 1U;]+E ,[^_]É+E ,[^_]UWVS,Eu9E )x9} U] E U)UBd$|$\$Pt9vvEMAhD$t$Ut$\$ $T$ PuE |M+E AUQ} v_A MƸqA,[^_]1,[^_]ÍU tE@@,[^_]ø뻉'UWVSEU ]EE9EvEE9‰EsF8ru#׉׋U9t$8tqC)ƃ[^_]ËE9Et=U9w=E+]9s$ω< t -< u&D9u1[^_]ÉپE<w둍&UE W}VS]9r 99s2{ tƋEȃ?‰ЋU1ȉ9r[^_]Ít&'U1WVS,] }9scE,fE̋ĶtO%U9ߍDEv+UBdUT$U|$ \$$P 9wՋE,[^_]Ë뱍&UU EUE ]_tt&'UWVSD$T$<$b9v)؍D$D$ $``]u}]É뾐Uuu]D$/4$`tD$.$O_t]u]Éމ]u]]H5UtaA]u r@]@uta@ w@+]r@퍴&U8E eU1ҋUuu]]E؉}_\$4$7`tf<;5<s&<Ct/-<<DUe3uS]u}]ËEUD$$[E‹<tD$$$D$bfU(]]u}$j[$`xV-<;5<s<Pu]u}]Ít&@<$ԍ&[E ‹<t4$D$$\$ $D$rU8}U }]]eE1؉u\$<$]$|Z;<r&<Ue3]u}]É$FZU<$T$45<&t<$Z<D똋E$D$r< 1Es} <|$҃D$ D$$$EY<`UWVS u }u &t|$$_cuED9v CSuӉʉBJu:1҃ [^_]ÉU^&W1V}EWفEɴ fEm}mEP,$؉m}mE ^_]Ë $ÐUt&W1V}EWفEɴ fEm}mEP,$؉m}mE ^_]ÐUWV(U Eu}U܋M܉EE׉ƋU؉E܅UEu"9wNEƋEt&;}v;11&ȋMt؃ڃ(^_]Í&ЋU1ӍvǃE +EME׋U NjEMMM ЋUEUԉ9Uԉr;Utm1dt&؃U]؃U]E&9}w 9u11EM9vO1UWVEU} EE҉։Eu9ȉ^_]Ðt&9ƒEt U+EME ‹EUMEEMM uщNjE9щƉUro9t^1yEt2ƋE^9w*U9Us"f11G&1uf1$EM9vO1 UWV0UEu} EEEUu}u9UEfM9MvuЉ}fEЋUԃ0^_]ÍvEE U+E܋}uEEM ‹EMUUM ЋUMuU9U;UM)щMM܉EMM ‹ẺUENEtEUEt&1ufE9EwU9UsUMUЉMME+EMEM9d)UZU]Ít&'UWVS^Ñ!SE)E}Ut+1ƍED$E D$E$9}u߃[^_]Ë$ÐUS E !$D$ED$T []ÐUS77t Ћu[]US[ø ]Y[MySQLdb - Cool Dog Interactive MySQL database connector3.5.0August 12, 2009MySQLdb(c) Copyright Cool Dog Interactive, Inc.http://www.cooldoginteractive.comStack memory limit %d, max %d
    getrlimit failed: %s setrlimit failed: %s soft limit set to the hard limit.ERROR_PAGE%s%sERROR_LOGCONTENT_TYPEmultipart/form-dataPATH_INFOMYSQL_VIEWVIEWDOC_TYPEEXTRA_HEADERSET_COOKIEIllegal program modeDEFAULTXMLOUTPUTTRUE G~kk~~)~J#~~SITE_INACTIVEhttp/MODEQUERYEXPORTEXPORT2INSERTDELETEUPDATECOPYEMAILDOWNLOADSETCOOKIEMYSQL_DATABASEEXTERNAL_APPSELECTSELECT_FILEALLOW_PATHSMYSQLDB_ERROR_PAGESETVARsecurity_checks: Beginning...
    security_checks: comparing form values to 'EXTRASQL_':
    EXTRASQL_security_checks: checking restricted form values for 'SRC_COOKIE':
    CK_security_checks: Finished., bad=%d

    Some name/value pairs disqualified. (%d)
    CHECKBOX_LISTREMOTE_USERAUTHENTICATEADMINadminparse_allow_paths: authenticated = %d.
    parse_allow_paths: Found %d paths.
    Mode SETCOOKIE called but no SET_COOKIE parameter provided.REDIRECTMode SETCOOKIE called but no REDIRECT parameter provided.SELECT %sIn download_file, query %s
    NORESULTS%d rows, %d fields matched query.
    HTML_NORESULTSIn download_file, number of records found was zero or more than one.htmlIn download_file, search did not return any results.file


    File: %s
    Ext: %s
    Type: %s
    Desc: %s
    Content-type: %s Expires: Thu, 01 Dec 1994 16:00:00 GMTapplication/pdfX-Pad: avoid browser bugAccept-Ranges: bytesConnection: closeContent-Length: %d Content-Disposition: inline; filename="%s" Content-type: %s; name="%s" set_cookie: string1='%s', string2='%s'
    EXPIRE_COOKIESet-Cookie: %s; expires=Mon, 05-Aug-2002 12:00:00 GMT; path=/; domain=%s PERMANENT_COOKIESet-Cookie: %s; expires=Mon, 31-Dec-2040 12:00:00 GMT; path=/; domain=%s Set-Cookie: %s; path=/; domain=%s FILEADM_FILECOPY mode must have a FILE parameter.REQUIRED.shtml.xmlCOPY mode must have a .html FILE parameter.../../index.htmlcopy_template: Invalid path specified '%s'REDIRECT_NORESULTSIn function export_records, %d records returned.
    RESULTSHTML_RESULTSFORMATHTML_HEADERHTML_FOOTEROUTPUT_DIRECTORYMode EXPORT Must have RESULTS, FORMAT, HTML_HEADER, HTML_FOOTER, OUTPUT_DIRECTORY%s%s/index.htmlwCouldn't write index file in OUTPUT_DIRECTORY%s%s/%d.htmlCouldn't write data file in OUTPUT_DIRECTORYREDIRECT_SUCCESSIn function export_records2, %d records returned.
    Mode EXPORT2 Must have FORMAT, HTML_HEADER, HTML_FOOTER, OUTPUT_DIRECTORY%s.txtTIMESTAMP2%s%s/%s.txtOUTPUT_FILENAME%s%s/%sCouldn't write HTML file in OUTPUT_DIRECTORYZIP_PASSWORD%s.zipcd %s%s; zip -lDmP "%s" %s.zip %s%.1lfNUM_KBYTESHTML_SUCCESS@@set_temp_variables: temp2='%s'
    set_temp_variables: varname='%s' parsed value='%s'
    In function query, %d records returned.
    EXTERNAL_APP_ON_NORESULTSGENERATE_MAILING_LISTREDIRECT_RESULTSGENERATE_MAILING_LIST must include RESULTS or REDIRECT_RESULTS parameter.RESULTS_SOLOFORMAT_SOLOHTML_FOOTER_SOLOMAILING_LISTgenerate_mailing_list: MAILING_LIST file not specified.generate_mailing_list: MAILING_LIST file could not be written.generate_mailing_list: %d records found
    generate_mailing_list: search did not return any results.%s SAVE_TO_FILESAVE_FILE_DIRgenerate_save_file: SAVE_FILE_DIR file not specified.SAVE_TEMPLATEgenerate_save_file: format='%s'
    SAVE_FILE_NAMEgenerate_save_file: filename = '%s'
    In generate_save_file, couldn't write save file.EMAIL_TEMPLATENeed EMAIL_TEMPLATE in order to send email.TEMP_PATHIn generate_email, temp_path = '%s'
    %s/senderr.txtIn function generate_email, %d records returned.
    %s/MySQLdb_gen_email_%d.tmp.txtIn generate_email, filename = '%s'
    Couldn't write temp email file.%s -t < %s 1> %sSAVE_TEMP_FILErm "%s"HTML_UPDATE_SUCCESSEmail was sent.
    sessionidadd_record: sessionid='%s'
    GENERATE_THUMBNAIL_FROMGENERATE_THUMBNAIL_TOALLOW_MULTIPLE_UPLOADin function add_record: added record id %ld
    %ldAUTORECIDHTML_ADD_SUCCESSCK_sessionidRESTRICTED_CHARACTERSRESTRICTED_FIELDSVALIDATE_DATESINVALID_DATEREQUIRED_BLANKvalidate_user_data: Found list of %d BLANK fields.
    REQUIRED_DATEvalidate_user_data: Found list of %d required fields.
    REQUIRED_DESC. validate_user_data: concat'd error string to '%s'.
    email
  • The email address you supplied is not valid. VALIDATE_EMAILSpasswordMATCH_PASSWORDSpassword2
  • The passwords you entered do not match.
    validate_user_data: Errors were found [%s].

    Created upload directories: %d '%s'
    rm -r -f "%s%s"System: %s
    REDIRECT_MISSINGMISSING_REDIRECTMISSING_FIELDSHTML_MISSINGMYSQL_TABLE1MYSQL_TABLE2CRITERIA1CRITERIA2index,CRITERIACRITERIAFROMCRITERIAFROM1CRITERIAFROM2UPDATE %s SET DELETE %sChecking field '%s'
    REPLACEFILE %s%s has a value [%s]
    %s/%sCommand: %s rm -r -f "%s"NOT removing directory/file '%s'
    %s=''%s=''%s=aes_encrypt( '%s','%s')%s='%s' WHERE update_record_into_db: numcriteria does not match numcriteriafrom.CRITERIA did not match name of database field. AND Update Query string:
    %s
    HTML_FAILUREHTML_UPDATE_FAILURE
    %d fields found:
    %d. %s, type = %d
    INSERT INTO %s VALUES( RECORD_ID'%s'timestampaes_encrypt( '%s','%s'))Adding record, querystring:
    %s
    REDIRECT_FAILUREHTML_ADD_FAILUREDuplicate entry 'The value '%s' you supplied is already used in the database. Please choose a different value.%s must have a unique value ('%s' already used in database).
    Please choose a different value.insert_record_into_db2: beginning
    USE_SINGLE_DIGITMAX_RECORDSREPEATING_FIELDSinsert_record_into_db2: Couldn't find list of REPEATING_FIELDS
    insert_record_into_db2: %d repeating fields, %d fields found:
    REQUIRED_REPEATING_FIELD%s_%02d%s_%dinsert_record_into_db2: found '%s'.
    send_query_string3: Raw querystring
    '%s'
    send_query_string3: Parsed querystring
    '%s'
    send_query_string3: Parsed querystring with encrypted fields
    '%s'
    PAGINATE_RESULTS%dPAGINATE_TOTALLIMITOFFSET LIMIT %d, %dTEMP: '%s'
    LIMIT %dPAGINATE_FIRST1PAGINATE_LASTIn send_query_string3: Formatted querystring
    '%s'
    WHERE GROUP BYORDER BYdisplay_records: recordcount=%d
    display_records: inside loop, i=%d
    HTML_HEADER_SOLOContent-Disposition: attachment; filename=%s Pragma: no-cacheExpires: 0 ALLOW_MULTIPLE_DELETEExtra SQL: '%s'
    uploaded_OPERATOR %s delete_from_db: numcriteria does not match numcriteriafrom.%s%s'%s'CLIKE%s%s'%%%s%%'SELECT %s from %s WHERE %sdelete_from_db (upload_ fields): [%s]
    Couldn't get list of uploaded_ fields.DELETE FROM %s WHERE %sDelete string:
    %s
    List to delete:
    %s
    rm "%s%s"delete_from_db: command [%s]
    rmdir "%s%s"delete_from_db2: No 'CRITERIA' specified.DELETE_ OR %s='%s' %s='%s'delete_from_db2 (upload_ fields): [%s]
    delete_from_db2: command [%s]
    rCouldn't read select file '%s'
    %sFROMWHEREORDERBYGROUPBYOPTIONALBad select file: Couldn't find 'SELECT' after OPTIONAL field.Bad select file: Couldn't find 'FROM' after OPTIONAL field.Bad select file: Couldn't find 'WHERE' after OPTIONAL field.,
    In function read_select_file (g):
    Select: %s
    From: %s
    Where: %s
    Orderby: %s
    %s FROM %s WHERE %s GROUP BY ORDER BY %sRaw select statement: %s

    MYSQL_USERIDMYSQL_PASSWORDMYSQL_SERVERMYSQL_DATABASEMYSQL_DATABASE not defined.MYSQL_TABLE/var/lib/mysql/mysql.sockError: %s
    mysql_real_connect SUCCESS
    ENCRYPTED_FIELDSread_encrypted_fields: found %d fields.
    Encrypted fields:
    TableFieldname
    %d%s%s
    ENCRYPTION_PASSWORDCouldn't allocate fieldnames in get_field_list.Couldn't allocate memory in get_field_list.Found %d fieldnames.
    i=%d field='%s'
    QUERY_THRESHHOLDMYSQL_VIEWVIEW /home/sites/mysql_queries%s/%s.txtQUERY_LOG_PATH%s%s/%s.txta"%s","%s","%s","%s","%d","%.5lf","%.5lf","%s","%s" LOG_QUERIESFALSE
    SELECT SELECT
     FROM FROM
     WHERE WHERE
     AND AND
     OR OR
     GROUP BY GROUP BY
     ORDER BY ORDER BY
     LIMIT LIMIT Select statement: %s

    Content-type: text/html%s %s version %s, %s
    All CGI Source code and executables by         Walter Patterson / Cool Dog Interactive, Inc.  http://www.cooldoginteractive.com              (C) Copyright %s, all rights reserved.       
    

  • Stopping here


    %s %s %s
    ERROR: %s
    Program ended.
    %s %s
    %d Name/Value pairs
    Numbers 0Data NAMEs 0 - %d Data VALUESource
    ---------------- ----------------------
    %02d%s%s%s%d
    Beginning parse_and_output_string
    parse_and_output_string: returning
    [%s]{%s}About to call complex_substitution
    calling substitute_string: fieldname '%s' substitute '%s'
    %c%cRENDER_USERTAGSparse_usertags: fieldname '%s' (%d) remainder '%s' (%d)
    %s %sparse_usertags: label '%s' table '%s' key '%s' html '%s'
    SELECT * FROM %s WHERE %s='%s'USERTAG%s %s %s%sOpening format file '%s'... read_format called without a valid file parameterrCouldn't read format file: %sOpened.
    Couldn't allocate format string.copy_file: filename=%s


    Couldn't find included file: '%s'


    copy_file_smart

    filename '%s' %d bytes read
    XMLOUTPUTTRUEContent-type: text/html copy_file_smart: Beginning parse_and_output_string
    copy_file_smart: Beginning parse_usertags
    parse_any_string: Found field {%s}
    parse_any_string: Found data value '%s'
    parse_any_string: Found FORM value '%s'
    parse_formatted_string: after parse_insert_select query=
    '%s'
    HTML_UPDATE_FAILURE%s%sFound row[0] value: '%s'
    After strcat, formatted='%s'
    #OFFSET_PREVIOUSOFFSETLIMIT%dRECORD_COUNTFinished parse_formatted_string: %s
    parse_insert_select: Found field {%s}
    parse_insert_select: Found data value '%s'
    parse_insert_select: Found FORM value '%s'
    parse_insert_select: Found substitute value '%s'
    parse_insert_select: substitute value '%s'
    from where ORDER


    ENTERING insert_query:Query="%s"
    Separator="%s" (%d)
    tempformatfile="%s"
    insert_query Select string: %s
    insert_query: Parsed querystring with encrypted fields
    '%s'
    SEPARATOR

    insert_query: found %d rows (sep %d).
    insert_query: Displaying record %d, (sep %d).
    %c

    inside INSERT_QUERY: temp length=%d


    inside INSERT_QUERY: retemp length=%d
    include_encrypted_fields: Query='%s'
    aes_decrypt(%s,'%s') as %s, include_encrypted_fields: Done, Query now='%s'
    *%s.*JanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprJunJulAugSepOctNovDec%c%s%cTHIS_URLHTTP_REFERERSCRIPT_URIREQUEST_URITABRANDRANDHEX%02xRANDCOLOR%02x%02x%02xLASTRANDCOLORDAY_OF_WEEKDAY_OF_WEEK2DIGIT_DATESLASH_DATESHORT_DATECURRENT_DATEMED_DATEDATETIMEXML_CURRENT_DATEOPTIONYEARS_ LISTYEARS_,%d %d LONG_DATETIMESTAMPSORT_CURRENT_DATEDIGIT_TIMECURRENT_TIMETODAY_YEAR%02dMONTHDAYMONTHSHORTMONTHLONGGENERATE_IDAdobe Illustrator documentWindows bitmapMicrosoft Word documentAutoCAD drawing fileAutoCAD exchange fileGIF image fileHTML web documentJPEG image fileQuickTime movie fileMP3 Audio fileMPEG movie fileUnknown documentMacintosh PICT image fileAdobe PDF documentMicrosoft PowerPoint documentAdobe Photoshop documentTIFF image filePlain text fileMicrosoft Excel documentCompressed ZIP archive fileK L (L @L UL kL zL zL L L L L L L L L L L M ,M EM EM UM eM ~M L kL L aibmpdocdwgdxfgifhtmhtmljpegjpgmovmp3mpegmpgotherpctpdfpictpptpsdtiftifftxtxlszipJPGGIFPDFN N N N N #N 'N +N 0N 5N 9N =N AN FN JN PN TN XN ]N aN eN iN nN rN vN zN ~N N DISK_USAGEERROR_STRINGFOUNDCOUNTFOUNDCOUNT2FOUNDCOUNT3%03dPAGINATE_LINKSFINDSUM_FINDSUM: '%d' decimal places, fieldname='%s'
    %.1lf%.2lf%.3lfOFFSET_NEXTDEBUG_INFOWHERE_CLAUSEFROM_CLAUSESELECT_STATEMENTSELECT_STATEMENT2SELECT_STATEMENT3LIMIT RECORDCOUNTEXTENSION_FILETYPE_ICONFROM_%s.gifALTTAGFROM_FILESIZE_FILELINES_found fieldname '%s' and filename '%s'
    NUMLINESfound filename '%s' lines %d
    WIDTHOF_HEIGHTOF_IMAGEINFO_IMAGEINFO2_IMAGEDATE_UPLOADDATE_IMAGEWIDTH_IMAGEHEIGHT_IMAGETYPE_UNHASH_UNHASH: buf='%s', retemp='%s' unhashed='%s'
    PASSWORD_PASSWORD: buf='%s', retemp='%s' DAY_OF_WEEK_AGEFROM_SORT_DATE_6DATE_MONTH_DAY_SLASH_DATE_SHORT_DATE_TINYDATE_TIME_%c%c:%c%c:%c%cTIME2_TIMEFROM_%c%c:%c%cTIME2FROM_TIME2FROM_ found dummy2='%s' (%d)
    YYYYMMDD%c%c%c%c%c%cPPdummy2 now '%s' (%d)
    %d:%c%c %sTIME3FROM_%c%c%c%c%c%cMED_DATE_MED_DATE2_MED_DATE3_MONTH_DATE_SHORT_YEAR_LONG_DATE_XML_DATE1_SHORT_DATE2_TIME1_%c%c:%c%c:00SELECTHOUR_SELECTHOUR: dummy2='%s'(%d)
    Found 8-digit time '%s'
    Found 14+ digit time '%s'
    SELECTHALFHOUR_SELECTHALFHOUR: dummy2='%s'(%d)
    SELECTMINUTE_SELECTMINUTE2_SPLITDATE_TOUPPER_TOLOWER_SPACETODASH_SPACETOPLUS_CLEANNAME__%20NOQUOTES_LATLON_SINGLEQUOTE_NOREQUOTE_REMOVECTRL_
    REMOVECTRL: field '%s'
    ADDBREAKS_
    ADDBREAKS: field '%s'

    ENCODE_%%%xENCODE2_INCLUDE_FILE_INCLUDE_FILE EXTERNAL_FILE_INCLUDE_FILE.html.txtCopying EXTERNAL_FILE: %s
    NAMED_FILE%s%s%sINSERT_QUERYINSERT_GRAPHSubst. value INSERT_QUERY, sub='%s'
    HAS SEPARATOR Sscanf '%s' '%s', select='%s'
    INSERT_QUERY: parse_insert_select="%s"


    INSERT_QUERY found:
    Format file: %s
    Query string: %s

    SELECT (scalar) found:
    Parsed Query string: %s
    IF CREATE_TEMP_TABLECREATE TEMPORARY TABLE %sTEMP_TABLE, query='%s'
    TEMP_TABLE, tempselect='%s'
    Finished creating temp table.
    HASRESULTS
    HASRESULTS path1='%s'
    path2='%s'
    query='%s'

    After HASRESULTS query: %d records found
    NULLINSERT_RSS_FEED
    RSS_FEED path1='%s' path2='%s' URL='%s'

    RSS_FEED_TITLERSS_FEED_DESCRIPTIONRSS_FEED_LINKRSS_FEED_PUBDATERSS_ITEM_TITLERSS_ITEM_DESCRIPTIONRSS_ITEM_LINKRSS_ITEM_PUBDATEWEATHER_INFOWEATHER: icao='%s', format='%s' nodata='%s'
    ./CDweather %s %s %sWEATHER command: '%s'
    No weather dataCITY_STATE_FROM_IPBeginning CITY_STATE_FROM_IP
    REMOTE_ADDRINCLUDE_APPBeginning INCLUDE_APP
    ./ext/%sINCLUDE_APP: '%s'
    INCLUDE_APP: Couldn't read pipeLEFTPAD_LEFTPAD: fieldname '%s', pad '%c', len %d
    RIGHTPAD_RIGHTPAD: fieldname '%s', pad '%c', len %d
    RIGHTPAD2_;-PHONEPHONE: fieldname '%s', ch '%c', value of fieldname '%s'
    PHONE%c: retemp '%s', temp '%s'
    TRUNCATE_chars_to_print = '%d' temp = '%s' TRUNCATE2_TRUNCATE3_

    Characters to truncate: '%d'
    PRICE_PRICECOMMA_%d,%06.2lfCOMMA_%d,%03d%d,%03d,%03dDECIMAL0_DECIMAL1_DECIMAL2_SMARTIMAGE_MAXWIDTH=SMARTIMAGE (1): max width %d
    ^SMARTIMAGE_DOCROOThttpSMARTIMAGE (1): alternate_docroot set to 1
    SMARTIMAGE (1): filename '%s' prepend '%s' options '%s' SMARTIMAGE (2): filename '%s' prepend '%s' options '%s'


    SMARTIMAGE sez: file=%s


    SMARTIMAGE sez: file exists.


    SMARTIMAGE sez: file does NOT exist.
    JUSTFILENAME_LINKFILENAME_LINKDOCUMENT_FORMATCSV_FORMATCSV: numoptions=%d
    FORMATCSV separator %s
    FORMATSEMICSV_REFERER_URLHTTP_REFERER: found '%s'
    URLPARSE_%3d=%3f?%26&ENV_EQUALSFound ENV_EQUALS env '%s' match value '%s'
    HASVALUE_Found HASVALUE_ fieldname '%s' value '%s'
    CONTAINSVALUE_CONTAINSVALUE buf2='%s'
    CONTAINSVALUE dis_present? %d
    Found CONTAINSVALUE fieldname '%s' substring value '%s'
    CONTAINSVALUE found substring.
    NOTCONTAINSVALUE_Found NOTCONTAINSVALUE fieldname '%s' substring value '%s'
    NOTCONTAINSVALUE didn't find substring.
    NOTHASVALUE_HASNOTVALUE_NOTZERO_ISVALUE_No strlen so far -- checking parent.No strlen so far -- checking env_variable.ISVALUE: dummy '%s', buf '%s', temp '%s', temp2 '%s'
    ISNOTVALUE_NOTISVALUE_ISNOTVALUE: dummy '%s', buf '%s', buf2 '%s', temp2 '%s'
    ISONEOF_ISONEOF: dummy '%s', buf '%s', temp '%s', temp2 '%s'
    ISNOTONEOF_ISNOTONEOF: dummy '%s', buf '%s', temp '%s', temp2 '%s'
    MULTISELECT_MULTISELECT: fieldname '%s' value '%s'
    MULTISELECT: possible values = '%s'
    ,%dMULTISELECT: Found %d values in field, %d possible values
    UPSELL_ITEMSUPSELL_FORMATHAS_UPSELLOPTLIST_skuopt%dnameopt%dvalueCUSTOMCUSTOM$
    Enter %s: Choose %s:
    EXISTSIN

    EXISTSIN: temp2='', temp untouched is '%s', dummy='%s'
    %s;

    EXISTSIN: checked parent, now temp2 is '%s'


    EXISTSIN: checked grandparent, now temp2 is '%s'
    ISSUBSTRING

    ISSUBSTRING: needle is '%s', hackstack='%s'


    ISSUBSTRING: after substitutions, needle='%s', haystack='%s'
    ISNOTSUBSTRING

    ISNOTSUBSTRING: needle is '%s', hackstack='%s'


    ISNOTSUBSTRING: after substitutions, needle='%s', haystack='%s'
    IS_EVENIS_ODDIS_MODISNOT_MODISNOT_MOD: buf='%s' (%d), i=%d
    OPTIONLIST_OPTIONLIST, Found fieldname '%s'
    optlist '%s'
    Found %d options
    SPLITDATE_M_Found SPLITDATE_M_ with fieldname '%s' value '%s'
    Found month, '%s'
    SPLITDATE_D_Found SPLITDATE_D_ with fieldname '%s'
    Found day, '%s'
    SPLITDATE_Y_Found SPLITDATE_Y_ with fieldname '%s'
    %c%c%c%cFound year, '%s'
    Fieldname: '%s'
    dis_present( '%s' ): %d
    Found value '%s' for fieldname '%s'
    PAGINATE_VIEW PAGINATE_SEPARATOR wJ?curl %s%s
    %s

    %s
    %s
    ITEM %d:
    item title: %s
    item description: %s
    item link: %s
    item pubDate: %s

    @...Couldn't allocate memory in left_pad_zeros
    Jump to URL = '%s'
    Location: %s Couldn't allocate memory in strip_spaces.Malloc failed in function str_case_str.Couldn't allocate memory to extract CSV list.Couldn't allocate temp memory to extract CSV list.,/,%s,%c%c%c%%20%%22%%2F%%26TM©®strip_html: '%s'
    CONVERT_LOWERCONVERT_UPPERCONVERT_MIXEDCONVERT_SMARTRESTRICTED_CHARACTERSRESTRICTED_FIELDSDOCUMENT_ROOTFound DOCUMENT_ROOT in envs, '%s'
    docroot.txtCouldn't get DOCUMENT_ROOT.Read DOCUMENT_ROOT from file, '%s'
    Found DOCUMENT_ROOT in form values, '%s'
    HTTP_HOSTSCRIPT_NAMECouldn't get script reference in get_script_namehttp://%s%senvCouldn't get 'env' variables!

    Environment Variables:
    
    

    Beginning EXTERNAL_APP
    EXTERNAL_APPExternal_app: was '%s'
    External_app: '%s'
    %+curl -s "http://maps.google.com/maps/geo?q=%s&output=csv&key=%s"200%s,%sdu -k %s | tail -1@@wc -l "%s"wc -c "%s"%ld

    This program took %.5lf seconds of processor time.
    This program took %.5lf seconds of real time.
    .A

    Error: execution took too long

    This application was automatically stopped after %d seconds because it was taking too long to execute. This usually occurs due to a connection problem, an unusally slow connection, or when trying to transfer a very large file.

    You may wish to go back and try again, or contact the web site administrator for assistance.inside image_date, file='%s'
    image_date: called with file %s
    /usr/local/bin/identify%s -verbose "%s" | grep -i date | head -1image_date: command: %s
    Failed to read file in image_dateimage_date: date: %s
    :inside upload_date, file='%s'
    %c%c%c%c-%c%c-%c%cupload_date: date: %s
    IMAGEINFO: called with file %s
    %s "%s"IMAGEINFO: %s
    Couldn't read image_info()
    IMAGEINFO: identify='%s'
    ImproperIMAGEINFO: temp1,2,3='%s' '%s' %s'
    image_info: w=%d h=%d type='%s' info='%s'
    THUMBNAIL_WIDTHTHUMBNAIL_HEIGHTTHUMBNAIL_CONTROLWIDTHGENERATE_THUMBNAIL_FROM%s.tn.jpggenerate_thumbnail: Image IN file '%s'.
    generate_thumbnail: Image OUT file '%s'.
    generate_thumbnail: Image size: %d wide by %d tall.
    generate_thumbnail: Desired aspect ratio: %.2lf
    generate_thumbnail: Actual aspect ratio: %.2lf
    generate_thumbnail: preferring THUMB_PREF_HEIGHT
    generate_thumbnail: preferring THUMB_PREF_WIDTH
    generate_thumbnail: Scale factor: %.2lf
    V-?70-quality %sJPEG_QUALITYCONVERT_PNGpng/usr/local/bin/convert%s %s -resize "%dx%d>" -strip "%s" "%s"resize_and_replace_image: command='%s'
    rm "%s"UPLOAD_FILE_TYPEDELETE %sREPLACEFILE %scheck_upload_file_types: extension list = '%s'
    [%d.] '%s'

  • Uploaded file (%s) not a valid file type, must be type '%s'
  • Uploaded file (%s) not a valid file type, must be one of these: %sUPLOAD_MAX_KBUPLOAD_MAX_WIDTHUPLOAD_MAX_HEIGHTUPLOAD_MIN_WIDTHUPLOAD_MIN_HEIGHTUPLOAD_EXACT_WIDTHUPLOAD_EXACT_HEIGHTfield '%s' replacefield '%s', sizestring '%s,%s' max_width '%d' actual width,height = %d,%d
  • Uploaded picture width of %d pixels exceeded maximum width of %d pixels.
  • Uploaded picture width of %d pixels is less than minimum width of %d pixels.
  • Uploaded picture width was %d pixels, must be exactly %d pixels wide.
  • Uploaded picture height of %d pixels exceeded maximum height of %d pixels.
  • Uploaded picture height of %d pixels is less than minimum height of %d pixels.
  • Uploaded picture height was %d pixels, must be exactly %d pixels high.field '%s' replacefield '%s', allowed KB=%d, actual KB=%d
  • Uploaded file size %d KBytes exceeded maximum size of %d KBytes.@@?RESIZE_IMAGEQUERY_STRINGCouldn't find request string in environment variables.SERVER_NAME//Couldn't find server name in environment variables./usr/lib/sendmail/usr/sbin/sendmailSENDMAIL_PATHSendmail was not found in /usr/lib/sendmail or /usr/sbin/sendmail. Try passing a value for SENDMAIL_PATHCHECK_SERVERhttp://%sGLOBAL1 POST GET COOKIEPATHINF VIEWGLOBAL2 APPBADSRC8UNKNOWNPOSTLOG%s%s/%s_%s.txtw Remote address: %s Referring URL: %s %3d %s %25s %-64s EMAIL_LOG_FILEEMAIL_LOG_FORMAT"%s","%s","%s"SEND_EMAILEMAIL_TEMPLATEsend_email: EMAIL_TEMPLATE file not specified.TEMP_PATHIn send_email, temp_path = '%s'
    %s/senderr.txt%s/MySQLdb_%s.txtIn send_email, filename = '%s'
    In send_email, couldn't write temp file.%s -t < %s 1> %srm %sSAVE_TEMP_FILESLOG_TABLELOG_TABLE_FIELDNAMELOG_TABLE_KEYNAMELOG_TABLE_KEYVALUEAUTORECIDUPDATE %s SET %s='%s' WHERE %s='%s'CK_cartid%d %lf%d %s / $ %.2lf%d %sUSERFILE_PATH%s%s/%c%c%c%c/%c%c/%c%c/%s.txtread_file_into_string filename '%s'
    read_file_into_string: Couldn't read file '%s'
    POSTGETCOOKIEPATHINFOAPPDEBUGOFFONCONTENT_LENGTHContent length: %d
    Couldn't allocate memory to read form values.STRIP_DANGLING_BRALLOW_RETURN_CHARSALLOW_MULTIPLE%s; %sFound matching ALLOW_PATHS '%s' allowed=1
    Done checking ALLOW_PATHS, allowed = %d
    read_view_file: Opening '%s'.... Couldn't find viewfile '%s'ERROR_PAGEDone reading view file, valc=%d

    ERROR_NAMEDEFAULT../OUTPUT_PAGE: filename '%s'
    MYSQLDB_ERROR_PAGE%s (output_page)

    Error: %s

    %s



    %s v%s, %s
    %s
    %s

    %3c%3e'`\@$~[]Couldn't allocate memory to insert [name,value] pair.PRIMARY_KEYSADDITIONAL_KEYSCouldn't allocate memory to read form2 values.HTTP_COOKIECookie content length: %d
    Couldn't allocate memory to read form3 values.$#$$$$$$$$$$$$$$$$$$$$#$(#CONTENT_TYPEmultipart/form-data--%s--%s--
    Content length: %d
    Content type: %s
    Boundary: [%s]
    Couldn't allocate content memory in read_multipart_form_values. This may mean a file was uploaded that is too large for the system to handle.In read_multipart: get_form_name returned name='%s', file='%s'
    In read_multipart: get_content_type returned type='%s' ext='%s' desc='%s'
    Read_multipart: type, ext, desc = '%s','%s','%s'
    UPLOAD_PATH/%s/%sCouldn't allocate content memory in read_multipart_form_valuesCouldn't write uploaded file '%s' as a temp file
    Uploading file: is_text_file=%d, ext='%s'

    chmod 644 "%s"filename_%sFILE_LINES_FIELDFILE_LINESCouldn't allocate memory in read_multipart_form_values (1).Couldn't allocate content memory in read_multipart_form_values (2).--.htm, .html, .txt, .text, .info, .readme, .css, .htaccess, .htpasswd, .h, .c, .js, .cpp, .java.%s,%s%s/%s%s%s/%s/%s%s%s/%s/%s/%s%s/%s/%s/%sFrom create_upload_directory: upload_dir: [%s]
    mkdir "%s"chmod 755 "%s"name=filename=Astound! DocumentDatawindow DocumentDSPtype DocumentFreeloader DocumentFuturesplash DocumentExecutable ProgramHIW DocumentICA DocumentImmedia DocumentMac BinHex DocumentMbedlet DocumentMicrosoft Excel DocumentMicrosoft PowerPoint DocumentMicrosoft Word DocumentMac Binary DocumentCompressed DocumentODA DocumentAdobe PDF DocumentPostScript DocumentRichText DocumentStudioM DocumentAsymetrix ToolBook DocumentTPL DocumentVocalTec DocumentAuthorWare Map DocumentAuthorWare Seg DocumentAuthorWare Bin DocumentBCPIO DocumentChat DocumentConnector DocumentCPIO DocumentC-Shell Script DocumentCUSEEME DocumentDirector DocumentDVI DocumentEnvoy DocumentFreehand Documentgtar Documenthdf Documentica DocumentJavaScript DocumentLATEX Documentmif Documentcdf Documentnc Documentscm DocumentShell Script Documentshar DocumentShockwave Flash DocumentSprite Documentsv4cpio Documentsv4crc DocumentTCL DocumentTAR DocumentTex DocumentTexinfo DocumentTROFF DocumentUstar DocumentWAIS Source DocumentWorldgroup DocumentZIP DocumentBasic Sound DocumentBasic Audio DocumentVoxware Audio DocumentAIFF Audio DocumentMIDI Sound DocumentMPEG Audio DocumentRealAudio DocumentWAV Audio DocumentAutoCAD DocumentFIF Image DocumentGIF Image DocumentIEF Image DocumentJPEG Image DocumentPNG Image DocumentTIFF Image DocumentVasa Image DocumentRaster Image DocumentMap Image DocumentBitmap Image DocumentGreymap Image DocumentPixmap Image DocumentRGB Image DocumentXBitmap Image DocumentPhotoshop Image DocumentPICT Image DocumentWindow Dump Image DocumentHTML DocumentCascading Style Sheet DocumentText DocumentReadme DocumentPerl Source DocumentC Source DocumentTab Separated Values DocumentSetext DocumentSGML DocumentSpeech DocumentMPEG DocumentQuickTime DocumentVDO DocumentVivo DocumentAVI Movie DocumentSGI Movie DocumentVideoGram DocumentFormulaOne DocumentVRML DocumentStuffit Archiveҕ ҕ     3 F S ` q       ͖     - - - A S d      ϗ      % = = N N N N ` m | | |     ʘ ٘     " 0 I I Y j z            Й     0 G G G [ o o o o        Κ        / C Y l    › ٛ      ! ! 0 O ] m  A   œ œ М          / B B B U i i i i w asnasdpsrtspfrlsplexeadricaimdhqxmbdppzppspotbinlzhodapsepsrtfsmptbktplvmdvmfaamaasaabbcpiochachatconcpiocshcsmcudcrdirdxrswadvievyfh4fh5fhcgtarhdfjslatexmifcdfncscmshsharswfsprspritesv4cpiosv4crctcltartextexitexinfottrroffmanmemsustarsrcwgsndauvoxaifaiffaifcmidmp2m3ummprmramrpmwavdwffifiefjpemcfraspnmpbmpgmppmrgbxbmpicxpmxwdcssreadmeplcrtxtsvetxsgmlsgmtalkmpeqtvdovivvivoavimovievgxvgmvgpvtswrzwrld96mussit       $ ( , 0 4 rN ]N 8 < @ N D H L TN P N S W [ _ c g k o s w {                   Ǡ ( ˠ Π Ԡ ؠ ܠ ߠ             " $ ' , 0 3 6 < @ vN C G J N R W \ ` d h =N l o s w { N  #N  5N 0N   eN iN         aN XN  PN   +N 'N  nN  ¡ š ǡ ˡ ϡ ӡ ء ܡ AN FN  9N                application/astoundapplication/datawindowapplication/dsptypeapplication/freeloaderapplication/futuresplashapplication/exeapplication/hiwapplication/icaapplication/immediaapplication/mac-binhex40application/mbedletapplication/msexcelapplication/mspowerpointapplication/mswordapplication/octet-streamapplication/odaapplication/pdfapplication/postscriptapplication/rtfapplication/studiomapplication/toolbookapplication/tplapplication/vocaltec-media-descapplication/vocaltec-media-fileapplication/x-authorware-mapapplication/x-authorware-segapplication/x-authorware-binapplication/x-bcpioapplication/x-chatapplication/x-connectorapplication/x-cpioapplication/x-cshapplication/x-cuseemeapplication/x-directorapplication/x-dviapplication/x-envoyapplication/x-freehandapplication/x-gtarapplication/x-hdfapplication/x-icaapplication/x-javascriptapplication/x-latexapplication/x-mifapplication/x-netcdfapplication/x-screencamapplication/x-shapplication/x-sharapplication/x-shockwave-flashapplication/x-spriteapplication/x-sv4cpioapplication/x-sv4crcapplication/x-tclapplication/x-tarapplication/x-texapplication/x-texinfoapplication/x-troffapplication/x-troff-manapplication/x-troff-meapplication/x-troff-msapplication/x-ustarapplication/x-wais-sourceapplication/x-worldgroupapplication/zipaudio/basicaudio/voxwareaudio/x-aiffaudio/x-midiaudio/x-mpegaudio/x-mpegurlapplication/x-mpeg-audioaudio/mpegaudio/x-pn-realaudioaudio/x-pn-realaudio-pluginaudio/x-wavdrawing/x-dwfdrawing/x-dwgimage/fifimage/gifimage/iefimage/jpegimage/x-pngimage/tiffimage/vasaimage/x-cmu-rasterimage/x-portable-anymapimage/x-portable-bitmapimage/x-portable-graymapimage/x-portable-pixmapimage/x-rgbimage/x-xbitmapimage/x-photoshopimage/x-pictimage/x-xpixmapimage/x-xwindowdumptext/htmltext/plaintext/richtexttext/tab-separated-valuestext/x-setexttext/x-sgmltext/x-speechvideo/mpegvideo/quicktimevideo/vdovideo/vivovideo/x-msvideovideo/x-sgi-movievideo/x-videogramvideo/x-videogram-pluginworkbook/formulaonex-world/x-vrmlx-worlds/x-d96application/x-stuffit   Ӥ    ' 7 G [ t       ȥ ȥ       ( < Q d    ަ    " : M _ _ u u u u      ɧ ܧ    - ? ? T l }    è ٨    $ $ : : : N f }   © ۩         , < U ` ` u     ê ͪ ת ת ת       / G ` x       ë ׫ ׫         " " . < < < G G W a a l |     ͬ ͬ ܬ ܬ  Content-Type: PATH_INFOContent length: %d [%s]
    Couldn't allocate memory to read path_info values (1).pathfound: '%s'
    Couldn't allocate memory to read path_info values (2).Couldn't allocate memory to read path_info values (3).CL: %s (%d)
    PATH: %s (%d)
    Couldn't allocate memory to read path_info values (4).Couldn't allocate memory to read path_info values (5).MIN_VALID_YEARMAX_VALID_YEARmy_days_in_month called with month out of range.12 a.m.1 a.m.2 a.m.3 a.m.4 a.m.5 a.m.6 a.m.7 a.m.8 a.m.9 a.m.10 a.m.11 a.m.12 p.m.1 p.m.2 p.m.3 p.m.4 p.m.5 p.m.6 p.m.7 p.m.8 p.m.9 p.m.10 p.m.11 p.m.e m t {          ı ˱ ұ ٱ         12:30 a.m.1:30 a.m.2:30 a.m.3:30 a.m.4:30 a.m.5:30 a.m.6:30 a.m.7:30 a.m.8:30 a.m.9:30 a.m.10:30 a.m.11:30 a.m.12:30 p.m.1:30 p.m.2:30 p.m.3:30 p.m.4:30 p.m.5:30 p.m.6:30 p.m.7:30 p.m.8:30 p.m.9:30 p.m.10:30 p.m.11:30 p.m.e  m  t  { ʲ  Բ  ޲              & ı 1 ˱ ; ұ E ٱ O  Y  c  m  w       %02d:00:00[00] Comparing hour '%s' to temp '%s'
    %02d:30:00[30] Comparing hour '%s' to temp '%s'
    %02d%02d%dmy_srand(): s=%s, i=%d
    %d:%02d %sSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSat%s, %d0000%c%c:%c%c:%c%c GMT%s, %02d %s %d %s0000000000000000000000000000000000-00-000000-00-00 00:00:00%s, %s %d, %d%s %s/%s/%s%02d/%02d/%d%s %d%d-%02d-%02d%s %d, %d(null)%s %d, %d%04d%02d%02d%02d%02d%02dBCDFGHJKLMNPQRSTVWXYZ23456789 i=%02d, buf[i]='%c', sums now %d %d %d generate_session_id: after 'for' loop, sum now %d, mod=%d generate_session_id: Final %d-digit sessionid = '%s' generate_record_id called, static 'done' = %d
    datebuf,timebuf,pidbuf = '%s','%s','%s'
    buf = '%s' (%d)
    %d%02d%02ddateSuMoTuWeThFrSa%02d:%02d:%02d%02d:%02d:%02d ET (%02d%02d GMT)ggggg6ֳ<L"&͸tB(4ݻĺuuuu@xxxttZxx16?gg6;   5.0.77set autocommit=1set autocommit=0rollbackcommit%-*.*g%.*fSHOW SLAVE HOSTSSHOW SLAVE STATUStcpMYSQL_TCP_PORT/var/lib/mysql/mysql.sockMYSQL_UNIX_PORTLOGNAMELOGINUNKNOWN_USER_W@@@P@?@%08lx%08lxAUnknown MySQL errorCan't create UNIX socket (%d)MySQL server has gone awayWrong host infoLocalhost via UNIX socket%-.100s via TCP/IPError in server handshakeNamed pipe: %-.32sEmbedded serverError on SHOW SLAVE STATUS:Error on SHOW SLAVE HOSTS:Error connecting to slave:Error connecting to master:SSL connection errorMalformed packetInvalid use of null pointerStatement not preparedData truncatedInvalid parameter numberShared memory: %-.100sWrong or unknown protocolInvalid connection handleCan't connect to local MySQL server through socket '%-.100s' (%d)Can't connect to MySQL server on '%-.100s' (%d)Can't create TCP/IP socket (%d)Unknown MySQL server host '%-.100s' (%d)Protocol mismatch; server version = %d, client version = %dMySQL client ran out of memoryLost connection to MySQL server during queryCommands out of sync; you can't run this command nowCan't wait for named pipe to host: %-.64s pipe: %-.32s (%lu)Can't open named pipe to host: %-.64s pipe: %-.32s (%lu)Can't set state of named pipe to host: %-.64s pipe: %-.32s (%lu)Can't initialize character set %-.32s (path: %-.100s)Got packet bigger than 'max_allowed_packet' bytesThis client library is licensed only for use with MySQL servers having '%s' licenseNo data supplied for parameters in prepared statementNo parameters exist in the statementCan't send long data for non-string/non-binary data types (parameter: %d)Using unsupported buffer type: %d (parameter: %d)Can't open shared memory; client could not create request event (%lu)Can't open shared memory; no answer event received from server (%lu)Can't open shared memory; server could not allocate file mapping (%lu)Can't open shared memory; server could not get pointer to file mapping (%lu)Can't open shared memory; client could not allocate file mapping (%lu)Can't open shared memory; client could not get pointer to file mapping (%lu)Can't open shared memory; client could not create %s event (%lu)Can't open shared memory; no answer from server (%lu)Can't open shared memory; cannot send request event to server (%lu)Connection using old (pre-4.1.1) authentication protocol refused (client option 'secure_auth' enabled)Row retrieval was canceled by mysql_stmt_close() callAttempt to read column without prior row fetchPrepared statement contains no metadataAttempt to read a row while there is no result set associated with the statementThis feature is not implemented yetLost connection to MySQL server at '%s', system error: %d User time %.2f, System time %.2f Maximum resident set size %ld, Integral resident set size %ld Non-physical pagefaults %ld, Physical pagefaults %ld, Swaps %ld Blocks in %ld out %ld, Messages in %ld out %ld, Signals %ld Voluntary context switches %ld, Involuntary context switches %ld BUMASKUMASK_DIR01230120022455012623010202nonestripedCan't create/write to file '%s' (Errcode: %d)Error reading file '%s' (Errcode: %d)Error writing file '%s' (Errcode: %d)Error on close of '%s' (Errcode: %d)Out of memory (Needed %u bytes)Error on delete of '%s' (Errcode: %d)Error on rename of '%s' to '%s' (Errcode: %d)Unexpected eof found when reading file '%s' (Errcode: %d)Can't unlock file (Errcode: %d)Can't read dir of '%s' (Errcode: %d)Can't get stat of '%s' (Errcode: %d)Can't change size of file (Errcode: %d)Can't open stream from handle (Errcode: %d)Can't get working dirctory (Errcode: %d)Can't change dir to '%s' (Errcode: %d)%d files and %d streams is left open Disk is full writing '%s' (Errcode: %d). Waiting for someone to free space... Retry in %d secsCan't create directory '%s' (Errcode: %d)Character set '%s' is not a compiled character set and is not specified in the '%s' fileOut of resources when opening file '%s' (Errcode: %d)Can't read value for symlink '%s' (Error %d)Can't create symlink '%s' pointing at '%s' (Error %d)Error on realpath() on '%s' (Error %d)Can't sync file '%s' to disk (Errcode: %d)Collation '%s' is not a compiled collation and is not specified in the '%s' fileFile '%s' not found (Errcode: %d)Can't lock file (Errcode: %d)Warning: '%s' had %d linksUnknown error %dUNKNOWNUNOPENED: ..ucs2utf8/usr/share/mysql/usrcharsets/.xml?#EgܺvT2latin1latin1_swedish_cilatin1_german2_cilatin1_bin(null)primarybinarycompiled&<<< %s %sxml.versionxml.encodingcharsetscharsets.max-idcharsets.charsetcharsets.charset.primary-idcharsets.charset.binary-idcharsets.charset.namecharsets.charset.familycharsets.charset.descriptioncharsets.charset.aliascharsets.charset.ctypecharsets.charset.ctype.mapcharsets.charset.uppercharsets.charset.upper.mapcharsets.charset.lowercharsets.charset.lower.mapcharsets.charset.unicodecharsets.charset.unicode.mapcharsets.charset.collationcharsets.charset.collation.idX X X r[ X X L[ [ X X Z Z pZ DZ Z Y Y Y X X X X charsets.charset.collation.namecharsets.charset.collation.ordercharsets.charset.collation.flagcharsets.charset.collation.mapcharsets.charset.collation.rules.resetcharsets.charset.collation.rules.pcharsets.charset.collation.rules.scharsets.charset.collation.rules.t d'@Bʚ; TvHrN @zZƤ~o#]xEcd #NJbig5big5_chinese_cibig5_binFGDXӡPѡҡDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrsDzǴǵǶǷǸǹǺǼǽǾǿVXELK¡JK¢ԡۡܡڡݡء١wxz{|}utsrq~bcdefghiponmlkjvy@BCqrmnuvyzijEefâĢŢƢǢȢɢʢˢƦƧƨƩƪƫƬƭƮƯưƱƲƳƴƵƶƷƸƹƺƻƼƽƾƿƣ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ǡǢǣǤǥǦǧǨǩǪǫǬǭǮǯǰtuvwxyz{|}~UVPQRTWSO@BCEVTWUFɣOMɢBA@CèXPcꦱYDd@D[G\EGFĨAAE^]ŨKöܲFƨGH_QɭǨȨE`ɨʨFGHRɱTSɵJKLMIPjfiQahNOHegɮ饱ɶɸɯfBgD[`hdG]Cb^ZeEH@FcAi\_aبШ˨ըΨ֨˼ި٨˵ۨϨԨ˴ӨרҨͨܨݨڨ˲Ѩ̨VJIQ]KYPXT[NWMURZO\SLH׭ѭ֭ĭͭڭέǭܭӭп̭˭ϭ[ƭխԭʭɭҭí­Эŭ٭ۭحȭcW\bԲUԶYRԴVԹgQfXԱSO]PNZ`aԷ[^M_dLTeԼȳ^Wų_UXijYdz]SRɳʳƳ˳Q\ZTóVʶĶͶƶǶŶ˶̶ɶܼȶζܹಹஹହ෹హ൹觾詾訾vwux_lkIaSRJIKߨ^YZ°\[`]^JK@LݭNTUAj`_ðUaޭ߭VBMNkha@LZİͳBɿYWXMNb¤ZkFDEGClmnPOSQRchdgfebѳŰikjlưγϳгжѶ϶ABỹZ@ABDCO\[HUVTWoplkijǰnʰmɰȰԳӳҳҶնֶԶӶCDEyUcäVĤŤ]^Iqm̰˰cbPƤ_ͰCl`KJXo׶EἹǤаΰϰQd͢ʤɤȤcbmnճRˤedrWgfLMsYZoD̤tuppdֳeFόFXhѰSeΤͤϤqOfjytonuslzmixwvkrq{pSYU[XNQTPWZORV\~{g|[]up}_ahxtv\mvsdnowljkq^rfczbei`yOPIKMLEADIRCFHQMSJGB@NHKxt}rCΣOΥyEBwͦJ|LΩs~{@ΡFGzvuDND@BCACFB@GѡEDAw䰧߰|۰v{zᰥsְٰ~ӰڰtԤݰux}ްܰװұذyణհ԰qrj׳ڳuxسq޳䳽n۳v{ofsmyݳ߳ܳzlrthwٳgip޶ܶ߶ڶݶض۶_ٶ͹ȹUQK¹TΌNPSĹ˹ŹIƹǹL̹JOùHɹMRʹGMGDGSTJBLRFIHHCEKAkONP䲾@EB鶾AC輾軾D@QF鷾{}~z|P`VQAY@XWZmonŦI}|_^]ywzxTHIEF밫|ϹιIHGkgYnobfdcea`}{ʬ~|Y[Z@XWV\AUTZX^UY[]WVQRέS\PSRWNQPTXGJOUIJVMHLԯԽԴԼԾԹԲԦذԵﰻԶKةإ}رخKѫ~ذد]йcչ_fW׹ѹ\U[dҹֹZ`eVԹ^bhXaӹgYYKWVMRNQ\[JPZOLXMOJLNþP¾IKSRabcB[hФ_عiSZB`YLi~pgh]ڹ۹ٹjѤӤҤ[ԤqijaC_`^ZabMNOݹܹj]ľklonqpmkʹʸʳʮʻʷʭʺʫgoOHpSDKfEdLPcQJMriTRnlIkGFjhqmeNoθgcsblξpοVvdfmqurknhëjitκe«\b[`PU_\aQ[TRcSWXZY]^d@CDBA@ؽBGCضADغطؼEصB@CD@FAABEnzpvkyx|u޹tm߹{orwqlsUaXWZ\_VT][Y_^c^`b`WVUXQRZSž\[TYƾT\]ClmnդrssUutVī]eEGF}Ǿ^prsvtuwʻWXvxzw{yȫūǫɫƫfwhgc_`bdafeJIHGKFIKHJHIJ~칡fged]Ⱦd_oxʫigNMLLMɾp\֤ty|KqפNLrؤuɧY~Z}Ϋxͫ˫̫jhkij^PQOhiaĨK٤swvzħ§çhb]̣ec\ilg`̥f̦ad[_ķ^j̢ΤΪΣΥ}{ΩyЫΨ|zϫ~έonlknposqpѮrmlmqrSRTXAZV^[UCWB\]YD@QROOPSVNPUTCRDMQegkhcbljjmdikfaf`e^hdic_gjbrDE`rqt{ʵ_uŧtWvwxڤѫSy]x|Ƨn̬m̩o̪ҫԫΰαβδӫtsvubFac`UEVWTZ\E[YXqompnlmklnnz~}FۤիXyzȧɧǧβ֫ιζκ׫yuwwxxvGJKHgfdeIhZ[\]_aHGY`^psrtqtuossqprofFGUʧث{ܤ˧٫|I}ݤޤɢ̧qrsp̸ګzzyiLjM]buvʾtstkJUΧͧ۫{mCnl^vLϧЧwv̻uݫܫޫ߫}|{OorpNuqPtsa_`KdLcwxwu@HIߤ{ҧԧɤӧѧxyا֧էק̢~̮̩©̭㫬éȩƩ|̥ͩ䫦ɩ{ʩ˩ǩ̩z̫ĩ}̡̤ũΡΤ~}|쫡򫢮~뫦﫥ΧvѦѨSլѣxQRѯѭѧywzU^d|e`ժVբ~TbeIcء]a{dYbWXէ[ի_դ\fcZ}ko@QmDqeFSilGHNsTJOC^UrAP]pNMtEjBKMRgLPh\phlnk[j_Z@qXimOfgAWYVo}GF|ECDzn᣼{HyBz~y~ξx娼̾嬼xv}w;姼孼|{˾zо~Ѿ|y{ӾҾ}ϾVgjihaJbAt|ɳڧ٧ϩΩѭur`atvuI宼ԾW¹ѩЩҩѰvQ~}ɷɪɩߧөާۧݧܧ᩾̷ܩ侀̴̺̼̿詸٩⩶שة֩ԩߩթ䩵کݩީ۩A@ѱCBEβDѿfѺѼ}սѾѿѸѵѶѹѻѻî®ѷg˱ʱyurզպwը̱ɱ{jȱiսs±hxqDZtդƱRoոñxnl~հıw|յpűmzvTSkdzjYgw}kn|\ml~Uyi_٥phq٭fec]٤VW{yXox`[٩a^p|ݱݶݪliz{bknoݸjd}ݺݨݩ~ݴݫݵݭehfݰݬSmgcݮQLKObR导T尼NPUJ嵼Zٲ¼M峼üؾپ߾־ݾ۾վܾ׾޾ھY­X^\]Zk[BEFDGlCNdMLKceuũrٯFGĮŮӱϱֱձαѱԱбvͱuxٰswtqVļżƼHyƮرױz{rW礸Hٱ|ٵs_IǮȮ۱ܱݱڱ}~پYXJIO^J餹@PMSKNQLORЮɮ̮Ϯʮήˮͮ߱խޱծ౩٨ݦټ١yvwu{ݻxtz\Z[ȼǼʼɼ澻辳徶`nKmQRfPŪTѮҰ̳|뤳BAҮӮԮ´zagɵɴCGBE@AA@FDWCMNFXHSIVQOJPDRUELTGK[\iVLbJ[EeRADQa`FX_`cZKSfYamVXCjc]@lgIkPHd\T^bGZYO_UWh]NMB^WU߮ծݮ֮ڮۮخ׮ٮܮյչսհղճ鱺շջޮִѴҴδĴǴƴ״ɴŴд̴ٰٵٯ˴ݱϴʴٴʹôٴȴټپ٪ӴմٹԴݦݨݬݡݯݣݰݪ~شݿݥݢݭJH^FX}_B]GUd][@ZoQamI^KYgDkaMCWh`eSfEPLN`_nObTcljAVibR\ͼؼռѼμּ׼ԼټӼмϼ̼Ҽ˼EAHIDJ@GCFBchibfegdQNWVTOrPqSpXRMoLVUUhYZTXSWvVYd۴ܴڴݲpceqdۼڼKjYwBZ[nk\eofp޴ݴfghܼLlZ_qgߴijݼ޼`CHrhsijBAC@@AAB@ݷkM[¥]a~ɻIJ^tklDBråƥťĥD@ŦƦ¦ĦɼEæ[YLQSLMUROQVZXZKM\TWEG^UNJYVHICOP[]PNS\WR]FTKXDjzqKbeBmovhfguGpnsJuycIMO@lk}rux|AF~wi_d`N{taL|ϡwϪϬtv{Iҭϭ{sd~xzϥ}}pϨzmϪxoϫ^H|wvnϬϩyϡqϢrϦy~LCU[WJMFGJV_E@NBOYDhHHEfZgaSb\ecITAG`FQCiPKKX]eRPG[UGDgdXcNOIE@QYBD^F\SHFJhb_]faR`AEWVTLKCMAZIMDJCUVHDBSKQWAGEBCOLT@FGFEPNR@a`F޽_IJǷh·^CȷRHKc޸jbW̷˷ŷi޹ULYeͷTMķ÷PZdGQ޼[ɷN޿ESgVlXfƷO޺ʷD]\⭺}⢺n⯺wmⱺqsuS殺}o⣺u~||vtzwxz~pyx{t⪺⤺sr⥺{y߼vDNMYKOFRTC^W[`UILH_aV\JE嫺AZB@XQP]GI@AHCOBDFEDJGFEB@ANCQSYWZRVU[TXPqopmnsrx_ey\vsgwt^abcf]udh`]j`kh_\^bedg[icfiaxyŭWeƣlǦA^_b_`aXZURTVͣSP͡WQͥYϱϵϵwxyPLnv{QlrkuqMOzjmst|pNmNPLXJWiH[RlSVZOTjkYMI[QUKHIeOYbXL`^_Jc\ZK]aMdpwyޡڷkҷz׷η}m~lܷxϷԷqٷ|ovrnѷطַӷ۷зuշN{st⵺gdpjlfnmkqhocebriJQUSKILMHUVGVQOLPNRRMNOPKTSWXT\b`^a]_wtuvlmzkji{ljkyRݷnb}ϹfP޷|gɦBȦedc`[Ϻϻҡ~S]^o\_RpQkjhilڦޥީާ޹⺺stYZr}qpnolǥCDfbaˬegcfgd_;]deab\ͯ^ͮc`ϽϿϼҥXWUҩTVg֣Ҫbfenyhcmtsadurq`ipwTvsVuoqtrUxS߷ެުᷮ⻺ޯvu~}{zwxy|_\]W[a`^decyx~mnmzȥYvjɥEljkhhimkgjf͵ilh¬ŬϿĬìҫҶҹҺҬҸҵҳҷ_]һҲ^Z\xmklstp{uroynwzqy[xwv|~`ڢZڥ[abX}{ڣz_|ڤڪY^\]W鷷跻޳޺޸޹޵޴⾺@bAifegfZcX\[dhYmzjhknlgBEu@oFD{ACGvtsnŲʥnͼҽ}]{ų˥o`ҿ~ºi^_ropqIH|w̥ƬͥңcdΥϥFjiǬϬХѥҥӥklnmrpqˬɬʬȬ`dcba{z֤feڧBjså|ԥsúopt͸ϬЬͬά̬hinlkjemfg֢֭|~֤֣}kjhlmgiگǺƺźȺECHIFGĺDlksmro`qabpntwuvMN}O~LPJxoKp~}ѬnoեʦGqmҬӬԬoqpJxQqp֥uprKtRrץ׬ج֬լqrs֯ڱsɺʺLducySsإnxwͼvͽy۬ڬ߬ެ٬ܬݬuvwtֲֳִֵַ֭֮֬ھںڻڽtCκFDEAB@̺ͺ˺NQOMP}~vzywfgex{|h@{A|z~}U¥¢T{yztwuvf٥ڥoxuGB|xۥz|~}{Ϳ|zҢyҥ}~{ֵֶַֺvڸwxNQMLHOPJKкԺѺӺIҺTXVϺSURYWjlikFECDVGZW[]\XY~}z}yq{|~rtsܥrªҧҦҬֻּּֿRSTA׺պֺCB@mHI_^áVݥrqpĪêҲ־}|z{yAZX@W\[YIHDغGFٺ^_[]Z\pErqnoJ`¨©ãޥHsƪŪ@ҷ~D]^CBJۺںKLa`sK¬uߥAҸڣEܺMݺvĥ˦ǪBC@BӹDGEFCҺHAƲòDzŲ²IJȲڧڥڬګڭaPSGLFcJHbONKMIR_Q]XNPUTWRQߺSY[VOi޺\bce`hdfgvjtxQyw{zONLPMucagedjkhib­«flðêîïóxwyŢXYm~̦EFDGHIIOMӻKLNJɲ˲ʲگVdTeUfa^`_ka|}WSXTVRUz{A@ͦtȪLJKZǯSYïRXV¯įUӽTȯůɯƯQPWϲֲӲٲزԲвѲҲײͲղ̲ڲڴlڳڶڻβh]_ae[Yj`d\XWbZ^kifgcrjxtxeubwfvpcqshgdlimynokpyurvltswqnzrm{o~꨿ꣿꦿꤿ_Yia]dg\e`Zhc^b[fntwµovq·msurpøô÷õ~}ĭBŹ@BAlΦoʯڲjCIɪuM`[_]˯^\@ijnohkgm@pz|}üDźϦ˪ʪONb̯aܲ۲BCAsmlnrq~꪿yxýüðЦPeίdcͯݲ޲߲Dop~CAB{|}桽歿꫿kz{lѦҦ̪ϯQӦARS@BԦTѯfӯЯүA@qզs˪CUhԯgկCBDFGEtuEDpomnq|¾Ť֦wµvFצئ٦vwwtvyu{zxxѪϪΪӪժҪ֪ͬЪ|Ԫͪ[GH]WZcaIgLd\YIbDeV_FK`OMXJ^NEfگد֯jޯۯlݯkinHomׯٯܯ߯NEGHPLJMQFOKIȵQOʵJۡɵNKŵ˵PǵMGƵL̵ĵõwu{sߢxr{}v~|~yxy}͵|tzLHMJKIAD稽C秽@榽B걿꯿txzwvusry¡}~ôijECDڦתRN{ۦSܦPTUVOݦتhpWۤP|µަ٪RεQEߦϵR঱iQrqWTVSUXYZۦߨSJFIKHG괿F}}X[AJKMNLˣ{ˡ|zy}~~jܪͷ۪ߪͿݪڪ͸ઽ쯻ުb\daqt]kV`cewUYWRo~svХf}^xФuy|mУ{lp_ZSXTgnХ[zAv}~x|ӵӤtsr\ۦz{ӡuӯӶӰӧӢwy^`ey]houbi@wrnj\aYfcsdzlkZ_pvA[gmxqtl`׵}۪ۧյhۣiwsߵt]赡u۬pnzԵrۭkdocaеjۨصݵٵ~ڵvfҵ^ۢ۫e൰qmѵ|xֵܵ޵ӵyg{bۦ_Uߵߩ߱߿߲߰߶߶߱۵߸߯߾߲߫ߴߺߪߧ߭߮`X[YZ]aU^WVTc\b_stgfb紽vu_c]pawZXdni綽Om[RU{\SQNe篽`h穽x|竽WkoTy粽L絽rVjP^Y筽l}zqMI@CEAG븿LFUOF귿JT뿿QDHBVSP빿W뽿MKNS@ERDAMOQIPBRJGUHTKLVCN~³°ĩĦĬīļJKIGHLEFGOhӷ@B|{굸~XZYWЧikjӿAFӽCӻHӾӹGDӺEBLK׫HF~שקפ׬׭ׯװ}Eס׮GIDMJ߽۱쵶ﵺ۸۵ۼ۷۹ۻߺ¸øĸ㻸jeghmilfd߲½k翽绽缽羽繽纽罽da븽kge`oĿ\hi_^lb]cn[mj¿ÿfY]Zag\pj_kfm^`nXldch[bieo¥įBEACDQON@PFMžZn妪GlNŸýĽſЭmIJNMKLPUTRS׻׽׷׾O׵״Q͸ϸǸθʸȸɸ˸Ƹ̸tBAv@nprqsoƽʽŽǽȽɽup|ʿwyȿquxƿɿ{stzrvǿrqwstuxvIKHJRHIKJPnWVиCFED̿˿y{zTS[oCA@BѸDIGH}|}LULqrpTRQXPYVSWUO_Y^`Z[X]\DFEICB@GAH߸ڸոָҸ޸׸ܸӸԸPMEJQٸGOKNLݸFظLx{NM}ϽOK䦻y۸|z~wJֽҽٽڽ˽սԽνͽӽнؽ̽׽۽ҿ~ͿӿϿٿԿпڿۿؿѽοܿտѿֿ׿~AO@BCĴij@NMPQAV[XWZYCB@A@MNgmRPDDZaTSܽݽvƨbHVUWQR䨻ݿ޽޿FE\[IYZX߿Gst]^hfcgedJLQSRUOKMTPN[TSU߽併࿴HIJRBS\ŬEBji\]꽺vu_XWV_b`ae^fcd఻VLNKMTowlk`[^Yl]\_Zhonpmrikgjqs[aYbX]c`_^W\ZAC@EBFDEA@CBDROSQPTľCEVDUa`^]bcF_\QPOpnƭ`UyxcabmnCAEFLHJBIKDGb@acuwv{xtyz|gfde䳻MNIJKLH@GFGHIXYWVZXYWFdeHGd@|GŰdA[д|У~{}zjgnilhekmfpzv~w|roq}uxty{sMeOgiNfjhGO~PEJCBMLKIN}DFHRCASDBQPOEŶUoRSQT˧ˬ˨˷˹мйп׺qprע׷lVWTܣnSYXk\R[PZUmQRnqim»ljpkhoYHJVWUQGZTFIXKLM]\[\ZfŻut@Asפ_a]`o^psUTSsuƻûŻĻtra^_M`[\JK]LOPNR_Q^]HIC]qoƼVĽqBxvzDywCԨBث@תCצAmljbqeovnyuciwhxzkrswutfrvtsdgpaWYeZ\f[db^c`Xg]_xǻz̻лȻɻ~ѻͻ|˻ʻyλ{wvϻ}RZUgPOVeTqcdNXtysowuhb}W~xmkfn{jzSv|rlQpYiDACB@@CEEBAD`YTc[eU_aWX]bjgk^Zhj\dfiSVscqalhrbetmpid`okugnBf@DACafOhIdjNJK`gMeL_cb^implnoijgkhųKMLNJDSRT_U^VruthsrpqwDxܥv{EFج}zyܣ|{~{hһջ׻ֻӻԻ[\MKIJFFNHLGnlmwxEGFPmlkXVYW¨˿˭@ЮЭEԢF~|}IصHKرJثGا}ܬ|~ܡܤjkiػڻٻGHOIoAGLضܦܯnomۻlܻPJptqusyBܧܳsprqݻ]^_`QNKPSLROMwvx~}z{|HISnQRoŵqEGFWCtQRDañSŲMuv޻߻cbdVUTTA@}{~|y@zJKpOPHiCBäqrWDXAçLMTQNصܷz|wx{yge[fYZU[YXVZWEJFIHGDBECèF@ĨAħQNOPrVUtsI`X仾hGíBĬuRStsuHO~}i\kjla_^]`\K^]_NLMRKQTSPOJHICDXWUTYvwWvVwaYPUﻭ`WVLòहࣹnqsrtpmocfdcihgbbaedZ^[]\Y_b`a@XcMïEFĴ`^]ca\Z[_bx~y[šZ}|Y{Xz}~{x|yzRSJvjkƴzluejmfdkNfde\ŤżbIhvwnqpoghfegOüPGgihTUVKcƶxiJ{ƬrzyiSRQ^Ũ]ũL|{}xvwsytru|j{z~jmltosqpnkCBDAuXWUTJKIHloVmsqkvjrnut`_ŴűŬpZ\_[`YW]X^MZ\[yxwzst}~okplmnz{~|vy}EF¦wYZ[MxOPNL}{|x~zwyabŽdſcŻindgkreosjcmlqphbfNOa]^`_ba|{x|}PQGQSRecT³tdHu¶rqLJKI\fvwd}uܶxRe~쪹]gy^ĸ|{zM}fN~hŽĻijTSgjihseÿtJJWY[_`cdghklopstwx{|ơǡʡˡȡɡ\MOQRST}~̡͡ΡޡߡLMNICH]^ϡAСDAGFաס֡HIϢТѢҢӢԢբ֢עآ٢ڢۢܢݢޢߢBġ@ABCaUbN΢0 00" 0& % PdRTUVW\ 1 34O 56[]78009:00;< 0 0=>0 0?@ 0 0AB00CDYZ[\]^    005 2  ; 0%%%%%&&%%%%%%2!> ?IJMNKL_`a "f"g"`""R"a"bcdef<")"*"" """33+"."5"4"@&B&A& &!!!!!!!!%"#"<0 ! !ijk333333333YQ[Q^Q]QaQcQUt|%%%%%%%%%%%%%%%<%4%,%$%%%%%% %%%%m%n%p%o%P%^%j%a%%%%%q%r%s%`!a!b!c!d!e!f!g!h!i!!0"0#0$0%0&0'0(0)0DS!"#$%&'()*+,-./0123456789:ABCDEFGHIJKLMNOPQRSTUVWXYZ1111 1 1 1 1 1111111111111111111 1!1"1#1$1%1&1'1(1)1NYNNNCN]NNNN?QeQkQQRRRSAS\SS N NN N+N8NQENHN_N^NNN@QRRCSSSWXY'YsYP[Q[S[[\"\8\q\]]]]]]r^^ __MbNN N-N0N9NKN9\NNNNNNNNNNNNNNNCQAQgQmQnQlQQQRRRRRRS9SHSGSES^SSSSSX)Y+Y*Y-YT[\$\:\o\]{^^___b6bKbNb/eeeeeefg(g kbkykkkkl4lkp*r6r;rGrYr[rrsNNNNN;NMNONNNNNNNNNNNNNEQDQQQQQQQ RRRSSSSNJSISaS`SoSnSSSSSSSSSSSSSSSSSSSSSVVY.Y1YtYvYU[[<\]]]^^s^|^____ bSbTbRbQbee.g,g*g+g-gckkll8lAl@l>lrssttuu(u)u0u1u2u3uu}vvvvwww:yytzzNNRNSNiNNNNNN OO OO OOOONNNNNNO OIQGQFQHQhQqQQQRRRRRRS!S SpSqS TT T TTT TTT TTTTTTVVV3W0W(W-W,W/W)WYY7Y8YYxYY}YyYYYW[X[[[[[[\y\]^v^t^____b b bbcb[bXb6eeeeeff g=g4g1g5g!kdk{kl]lWlYl_l`lPlUlal[lMlNlpp_r]r~vzs||6 3 nr~k@Lc!2NNMOOOGOWO^O4O[OUO0OPOQO=O:O8OCOTOT&TNT'TFTCT3THTBTT)TJT9T;T8T.T5T6T TWPWOW;WX>YYYYYYYYYYYYY][\[Z[[[[[[,\@\A\?\>\\\\\] ^^^^^__d_b_w_y_________bbbbbbvbbmbb|b~bybsbbobbnbbbbb9e;e8eef_gNgOgPgQg\gVg^gIgFg`gSgWgekkBl^llllllljlzllpllhlll}llrl~ltllvlllllvp|p}pxpbrar`rrrs,u+u7u8uvvwyyyvz|Uo҉7FUdpʎƏŏď]IƑ̑2.1*,&NVNsNNNNNNoOOOsOOlOOOOOpOuOOiO{OO~OOOzOTQRQUQiQwQvQxQQQ;R8R7R:R0R.R6RARRRRSTSSSQSfSwSxSySSSSsTuTTxTTT{TwTTTT|TTqTvTTTbThTT}TTVWwWjWiWaWfWdW|WYIYGYHYDYTYYYYYYYYYYYYYYYYY_[d[c[[[[[[[\H\E\F\\\\\\\\^^^^^^x^^^^^^^&_'_)____|______``/`5``*``!`'`)`+``bb?b>b@bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb>eeeeff fffffff ff g gmgggqggsgwggggogpggg~gguggg|gjgrg#kfkgkkllllllllllllllllllllllllllllllllllppppp,r-r8rHrgrirrrrrrsssss=uuuuvvvvww>y@yAyyyzzyzz|T NqRhˎΏԏяǑёw@?;DBR^NNNOOOOOOOOOOOOOOOOOOOOOOWQQQQNRCRJRMRLRKRGRRRRR SWS{SSSTTTTTTTTTTTTTTTTTTTTTTVWWWWWWWWUYQYOYNYPYYYYYYZYYYYZYi[[[[[[\N\O\M\K\\\]^%^^}^^^^_-_e________`` `%``(`M`p`h`b`F`C`l`k`j`d`Abbc cbbcbbcbbbbbbcc?eEeeee%f-f f'f/ff(f1f$ffgggggggggggggggggggggggggjkkkkkkll m2m*mAm%m m1mmm;m=m>m6mml9m'm8m)m.m5mm+mppppppppp0rrrortrrrrsssssssu-uOuLuNuKuuuuuuxvvvvvvvvwvv w wvvwwxx x xFyIyHyGyyyyyyzzzz}|}}} }}}}8 6րڀÀĀ̀ۀ΀ހ݀"ۂ ҂ׂ܂Ԃтނӂ߂Py{zMkԉts͎̎ʐΐÐKJ͑PKLMbi˗ۘߘXNN P P#PO&P%PO)PPPc/cUcBcFcOcIc:cPc=c*c+c(cMcLcHeIeeeeBfIfOfCfRfLfEfAffggg!h8hHhFhSh9hBhTh)hhhLhQh=hgPh@hSSfFUjUfUDU^UaUCUJU1UVUOUUU/UdU8U.U\U,UcU3UAUWUW W WWX XXWWWX5XWW YbY6ZAZIZfZjZ@ZwUUUUUU~UUUU W/X*X4X$X0X1X!XX XXX`YwZZZZZZs[q[[[[[ \ \1\L]P]4]G]]E^=^@^C^~^^^^^<_m____`````a#a`a```ha`a` aaabIbcccccccccccccccvccccRdcc^efebeceeeenfpftfvfoffzf~fwfffgghhhhhihhhhhhhhhh iiihhnih>k:k=kkkkk.l/l,l/n8nTn!n2ngnJn n%n#nn[nXn$nVnnn-n&non4nMn:n,nCnn>nnnnNncnDnrnin_nqq&q0q!q6qnqqLrrr6s%s4s)s:t*t3t"t%t5t6t4t/tt&t(t%u&ukujuuuuuuuu{v|vvvvvOww]xlxox zz zzzzzzzzI{V{F{P{R{T{M{K{O{Q{||^}P}h}U}+}n}r}a}f}b}p}s}U RUTKQN9F>LSt Ń W ̃ʃ8܃ԃ߃[߆نԆۆІކWˆ;`U^a4a'a aa7a!b"bd>dd*d-d=d,dddd d6ddddleeeffffffffgimiZiwi`iTiui0iiJihiki^iSiyii]ici[iGkrkkkkknnnnnnnnnnnnnnnnnnnnnnNqYqiqdqIqgq\qlqfqLqeq^qFqhqVq:rRr7sEs?s>sotZtUt_t^tAt?tYt[t\tvuxuvuvuuuuuuvv[wkwfw^wcwywjwlw\wewhwbwwxxxxxx|xxxxzyyy,yzz zzzzzzw{{`{n{g{|||}y}}}}[}nijrVXqpxenskyzfGw=1ufkIl[<5acimF^\_ Y߈Ԉو܈؈݈ʈՈ҈krsfip|cqmbnly{>hbʌnjȌČ̌Ōߍ捲 KJSBTAljiɑ7W8=@>[KdQ4IME9?Z͖˖ɖʖVtv  霂 PPPPPPPPPPPPbQQRR1SSUVVVUVV V VVUVVVVUWWuX~XXXXyXX}XX%Y"Y$YjYiYZZZZZZZu[[[[[[[[[[ \b\]][^c^U^W^T^^^ _F_p__Ga?aKawabaca_aZaXaua*bdXdTddxd_dzdQdgd4dmd{dreeeefffiiiiiiiiiiiiiiiiiiiIkLk3l3oonon)o>o o,ooo"onno1o8o2o#oo+o/oo*ononnnqq}qqqq>rrrDsPsdtctjtptmtuu'v v v vvvvw}wwawxxxxxxyyy.z1zzzzz{{{u{{{{{{{{|||}}}}}}}}}}}}}}}}}}}p^ZPKɄƄĄ˄ӄфʄ?;"%4U7)jӌьҌk`X\cY^b][uxwtx{|̖Җ| AB󜼞;JQQPPPQQ QQQRRRRRRS.V;V9V2V?V4V)VSVNVWVtV6V/V0VXXXXXXXXmY [Z [Z [[[[[[d\e\]]b^_^a^^^^^^^H_q___vagana]aUaa|apaka~aaaaaaaaaa.bidodyddddddddddddddddddduewexeffff#jjijjji!jj jijjijPkNkkkk?o|ooQofoToomo[oxonoozopodooXonoo`o_oqqqqVrrNsWsittt~ttu v)vv$v&v!v"vvvvwwwwwxxxxxxxx?z~F~7~2~C~+~=~1~E~A~4~9~H~5~?~/~DqrposƁÁɁ q~gч҇Ƈȇˇ;6D8= A?sIKHJD>BE?}9M(uJeK~l[pZTʕ˕̕ȕƕ֖ӗF5;?Ϟޞܞݞ۞>KSVVXX8[]_a3bdddedddef&gjjjjjjjj_kxkk p popoppqqqqwsusttuVvXvRvwwwwyyazbz`zzz+|'|*||#|!||T~U~^~Z~a~R~Y~Hwv́ρ υͅЅɅ(9,+PYcfd_UIMБԕ֕ЕՕܖٖۖޖ$MOLNS>?=.ONMʛɛțQ]`,3QVXXX[^aaaaeeffjjjjpp(pppppr rXrrxszstttuu_vavwyykziz>|?|8|=|7|@|k~m~y~i~j~s~؁݅Յ `_V^A\XIZNOFY |rvlztTNѓߓÓȓܓݓ͓֓ؓדܕ*'aܗ^X[EI ֛ۛarjlRVVVVVX@[C[}[[]aaeeef'gj>p0p2pr{stbvev&y*y,y+yzzL|C|M|||}~|~~Lځf  dplfo_k ˑ0ĘRQ+075 y/_ca7Q8QVVVYl\]aaeeefjkjkLprrttivwP|~~-#"!jltw}_.35:82+892geWEC@>ϚTQ-%\fg×kUUMҚI1>;ӝם4ljV]b#e+e*efktzd|c|e|~~~8?1c`dho\Z[WӚԚњTWV坟VX,e^pqvrvwP69bwjBHDƗp_"X_|}wr^kcpl|n|;rpq^֚#̞dpwwɗbe~ő}~|wxT(rj1r|0000A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO`$a$b$c$d$e$f$g$h$i$t$u$v$w$x$y$z${$|$}$BN\NQSSN NGNNV n\s_NQN.NNNNNQRlSS WY,Y\]ekkl?r1Ng9g8g;g:g?gOgORO_OAOXO-O3O?OaOQQRR!RRR ScSrSSS0T7T*TTTETTT%TT=TOTAT(T$TGTVVVAWEWLWIWKWRWY@YYYYYYYYYYY[[(\*\\\\\\\\\\\] ^^^^^^^__x_v_______________`_:bbbbbbbqb{bzbpbbbwb}brbtb7eeeeeeEgGgYgUgLgHg]gMgZgKgkllxlglkllllqlolillmllllflslel{lltpzpcrrrrrrrrsssss:u9uuuv=y4xɏ0(/-3NO|OO}OOOvOtOOOwOLOOjOOyOOxOOOOOOOOkOnOQQQ5R2R3RFR1RR S SuuuvvvvvwwwwwwBy?yyxz{zzu||5 ‚ÂpomnVҏˏӏ͏֏Տ׏9=<:COOOOOOOOOOOOOOOOOOODRIRRR=S|SSSSSTTTTTT TTTTTTTpTTTTrTTTWWWWWWWWWWWWWWWX YSYYYYZYYYYYYYYYYYYYYYYY[L\\\\\\\\\\\\\\\\\\\\\]!^"^#^ ^$^^^^^^^_._V__7`9`T`r`^`E`S`G`I`[`L`@`B`_`$`D`X`f`n`BbCbb c cbccbbc cbbcccbcbbAeCeee6f!f2f5ff&f"f3f+f:ff4f9f.fgggggggggggggggggggggggggggggggggggggggggg(kkkkkkk l!l(m4m-mm9/%3-DQ%V?A&"BN*ZMZ9ZLZpZiZGZQZVZBZ\Zr[n[[[Y\] ]]] ] ](] ]&]%]]0]]#]].]>^4^^^^^^6_8____`````````````````````2ceccc}ccccccccocccnccuccmcc|cc;ccxcccccpcSeeefaf[fYf\fbfgyhhhhmhnhhhViohhhhuhthhhwhh|hkhrhhhqh~hhhhhhhxh{hhhh}h6k3k7k8kkkkkk*lmmmmtnmmmmmmnmmmmmmmmmmmmmmmmmmmmmmmmmmmp qpqp qpqpqppqqqpp qqq~r{r|rrsssss ssrssssssttsttsss t tstducuuuuuuuuvvv9w/w-w1w2w4w3w=w%w;w5wHxRxIxMxJxLx&xExPxdygyiyjycykyayyyyyyzzz5{G{4{%{0{"{${3{{*{{1{+{-{/{2{8{{#{||||5}=}8}6}:}E},})}A}G}>}?}J};}(}cGCH%-,!'"83:42tzstu}~vYV†ņȆ̆ÆR։ىՉ0',9;\]}}{y؎ގݎ܎׎$  !ԐVXZSUz|mkqoj嘗PPPPPPPPPPhPPPPP_QQSSSSUUUUwUEVUUUUUUUUU}UUUUUUU W)X7XXX'X#X(XWHX%XXX3X?X6X.X9X8X-X,X;XaYZZZzZZZxZZ|ZZZZZ7ZZZZZZZ{Z}ZZZZZZ[[[[[[[ \0\7]C]k]A]K]?]5]Q]N]U]3]:]R]=]1]Y]B]9]I]8]<]2]6]@]E]D^A^X____``````a` aaa`a````aaaa`a aJbccccccccdcccccccadccccccccccccccc2egejede\eheeeeeeeee|flf{ffqfyfjfrfg ihih*ihhhihhhhhiihhihipihihhihhhhh i iihhhhhhhihhi%ih9k;k?k?efQOPԀCJROG=M:<=?u;σ#ƃȃヿ݃؃˃΃փɃ ރƒՃǃуÃă׃ۃ؆ӆچ݆܆׆цHVU׈Ɉ݉ډۉNM9Y@WXDERHQJLO_؍Ӎ͍Ǎ֍܍ύՍٍȍ׍ō-4/,ad_b` %& '${~–ȖÖlpnNNNPPPPPPPPPPPPPPPPPQzRxR{R|RUUUUUUUUUUUUUUUUUUUUUUUWSXhXdXOXMXIXoXUXNX]XYXeX[X=XcXqXXZZZZZZZZZZZZZZZZZZZZ[[[\3\q]c]J]e]r]l]^]h]g]b]]O^N^J^M^K^^^^^^@___`IaJa+aEa6a2a.aFa/aOa)a@a bh#b%b$bcccdd d d$d3dCdddd9d7d"d#d d&d0d(dAd5d/d dd@d%d'd dcd.d!ddoeeeffffffffxf gfi_i8iNibiqi?iEiji9iBiWiYiziHiIi5ili3i=ieihxi4iii@ioiDiviXiAitiLi;iKi7i\iOiQi2iRi/i{iF 2*-<:15B&'8$0눝艫=hiՌό׌   # "$!zrysvzy}~-X}z~{Η͗ٙǙ>?`a_PQ0QPQQPP Q QP QRRRRHVBVLV5VAVJVIVFVXVZV@V3V=V,V>V8V*V:VWXXXXXXXXXXZZZZZ[Z[Z[[[[g\]]]]]]]]]]]]i^]^`^\^}^^^I__aayaaaaaaaaaaaaaafaa-bndpddddddddddddhdddvezeye{eeefffffffjjjiijii jiiijji'jiijii@jjii jii jjj%jji&jjijQkkkkkllklAo&o~oooooooboOooZoovolooUoroRoPoWooo]ooaoko}ogooSooiooocowojo{oqqqqqqqqqqqqqqqqqrrXsRs^s_s`s]s[sasZsYsbsttttt}ttt|tytuu~u%vvvvv#vv(vvvvvvwwwwxxxxxxxxxxxyyyyyyvk9zzzz{{{{{{{{{||||}}}}}}~}}}}}}}vdgOSRPNQ$;)  '+ *(.1& 0 /bVcdwsXT[RaZQ^mjPN_]olzn\eO{ubgiZ   ϊƊӊъԊՊ׊Ŋ؊Êي>Mߌٌڌ݌猠 #%$.&',$ #spogk/+)*2&.ВÒĒْϒߒؒגݒ̒’ʒȒΒ͒ՒɒޒђӒƒ|ӖZЗϗ&)( 'ܙ͙ϙәԙΙəؙ֙˙י̙FCgtqfvuphdlӞQQQQQQ4SSpV`VnVsVfVcVmVrV^VwVWWXXXXXXXX[[[![[[[[([[ [[[]]]]]]]]]]]]]g^h^f^o^^^^^^K__aaaaaaaaaaaaddddddddddd3ee|eeffffffffff#g4jfjIjgj2jhj>j]jmjvj[jQj(jZj;j?jAjjjdjPjOjTjojij`j[qNnuUg`f]Telcedy&0-.'1")#/,݊ߊȊފln3>8@E6<=A0?6.52974vy{356'z8<#F- ˒%4$)95* ͕Ԗ 5/2$')癹3|~{z}% )"՞֞=&Q%Q"Q$Q Q)QRVVVVVV~VVVVXXXX-[%[2[#[,['[&[/[.[{[[[]l^j^__aaaaaaaaaddddddeeeefjjjjjjjjjjjjjjjjjjjjjjj[kk looooooooooooooqqqqqqqssnsostttttttttuuuuuCvHvIvGvvvwwwwwwwwwxxyxxxyxxyyy\z[zVzXzTzZzzzz||{|{{|{ |{| |||{{|{{| ||-~<~B~3~H8~*~I~@~G~)~L~0~;~6~D~:~E~},ā́ʁŁǁ[Z\{w|zxWyvhŇɇLJ̇ćʇއ53<>AR7B " OprqooNMSPLGC@~8dVG|X\vIPQ`mLjyWUROqw{a^cgNYǕɕÕŕ ՗ԗADJIEC%+,*32/-10H3Ag6./180EBC>7@=-Ȟڞ$#"T1Q-Q.QVVVVVVpY<[i\j\]m^n^aaaaaaaaaadeddeedeefffjjjjjjjjjjj^kk lp p pppppopo&poo prqqrqvsttttttttuu\vdvYvPvSvWvZvvvvwwx yyy yyyyyy_z|)|| ||-||&|(|"|%|0|\~P~V~c~X~b~_~Q~`~W~S~uсҁЁ_^ƅŅDžą˅΅ȅŅ҅$iۇ߇ԇ܇Ӈ؇㇤ׇه݇SKOLFPQI*'#305G/<>1%7&6.$;=:Bu\b`WV^eg[Za]iTFGHK(:;>ҕӕѕזږ]ߖؖݖ#"%חٗ֗ؗPQRA<:  ܚ)5JLKǛƛÛӛě\SOJ[KYVLWRT_XZߞ%+*)(LU4Q5QRRSVVVVVVXXXY=[>[?[]p^_aee e e eeeeefjjjjjjjjjjjjj`kk lp'p pp+p!p"p#p)pp$pp*p r rrrrrrrrrttttu`vwwwwyy!yyyyygzhz3|<|9|,|;|||v~u~x~p~w~o~z~r~t~h~KJxׁՁdacمڅׅ؅߅܅хޅ  bZ[Wa\X]YPHJ@SVTKUQBRWCwv mxsjo{ŽRQOPS@?ޓǓϓ“ړГ̓ٓʓԓՓēΓғ}ڕە)+,(&ݗޗߗ\Y]WHGC%$" '#š  7ޛԛכܛٛ՛ڛwqx}ktupis{oyh-@AMVWX7SVVVXE[]]^^__aeeeeefffjjjjjjjj02.3vtsEdcbU]W^ėŗVY RXPJMKUYLNžО876COqpnoVVN[m\-effk_pap]p`p#rttw8yyyj|~mC875K‘khiFCGǗ^՚Ycgfb^` FtuvV.eekkkkbp&rrww9yi|k||~~~~FGHyz|{nmoqsIr_hnm  Gx{zyWfpo|<Ñtxvu`tsqu hpep|j>=?ɎKst̘adfg$Hbk'rLih.)rKyuvkzipjp~IxψXR`|Z#$%&'()*+,  !  !""""""    FGHIJKLMNO #$',-.158=>?@B #$',-.158=>?@B"!3246DCE"!3246DCE/ &%()+*0:9<;A7/ &%()+*0:9<;A7 *,.39;=EGMWY[aioy{})+-28:!'%#46JHNPTR^rpvtl 4 $5 (6 7 7 7 7 7 7 7 C7 7 7 latin2latin2_czech_csch //Ch 00CH 11 C Ԫ *,.39;=EGMWY[aioy{})+-28:!'%#46JHNPTR^rpvtlcp932cp932_japanese_cicp932_binN}L~ƒÃăŃƃǃȃɃʃ˃̃̓΃σЃу҃ӃԃՃփF@ABCDEGHIJKLMNOPQRSTUVWXYZ[\]^_`pqrstuwxyz{|}~v]\efghdcTUVWXYZ[\]@ABCDEFGHIˁ́́݁΁ށ假ځaȁɁ߁ہ܁@ABCDEFGHIJKLMNOPQRS@ABVXYZqrstuvwxyzkl‚ÂĂłƂǂȂɂʂ˂̂͂΂ςЂт҂ӂԂՂւׂ؂قڂۂ܂݂ނ߂JKTU@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~E[RSei`cakjdlfn_mbgh~rsopqutꈚO㏺s^NuhۊO厥TvVRh娘揩T\]݌܌jiS划lYmwedtWiߗȈ‹Cjkl˜Ɉތꊚx`ĘLmfϒAȘʈZC̑nǘ]ØŘƘCΘјϘɘ͘gҘʘp˘ИorӘ̘qˈDN֕Warsטܘژ՘ؘۘ٘ە֘MݘޘCoUvqŒ{|ߘw؎ul㘑ϗ`tzẍΕyÎUT{PÍbBXC͋@AlD}EHFmGI|KJƕVMNLQPOԘRSDזUTWVXYZ[~[ƖeZ\}]S_`ZaTbc~fečgh`ijkʎnlmyopq~ustrvwxyyÙzË{}}~MʓonؐYʕh䒍퍎OU܍菛nc͗wwJNuEו啫΋MَܖkxٔC\ߌ™ڔ쑦PmęTřƙK늌pəșʙ˙З̙Ι͙~X}ϙЙљQҙyFofՙbpÌٙ@ڙؙ‰䑶jEiۙܙhegݒD@fNi۔܊ߙzݙޙCۓČaB@]PDCiAƍENFGLKNMJSOHISBYXOPUR[VWTZQ`ea\fPhA^b[슅c_igridcmkpjnlkorwutQÉqsRv܉}{|~\XxyӓdXdlc͈}Ōޕyݍ\nϋVBRؒ^C_Wu|x͑š‘ÚĚƚꁉgۗ̚ȚY˚h˒ǍǚUɚŚo͚mΚĒКnњ֚՚ϚҚԚǕךdؚٚښܚۚޚӚߚݚmpsᚺ누ْϕ蚟ĉ[OǙgVvΈޓt_zDz@DA@ܔϖDJWdBEÑWiFȍGonƌψKLIWHÖPpЈQORPNPMؕVWSKkUXwYT}ZQ[_\ʼn^]kda`bcefhgilڒdjmnqopqrEstuyFЖGnjvwwxyz{}~FvG@蒶Xq鐺G{ɍQƉeh⎃ГxQ@ljJ˞RΑˎшqޖċAڎKsANj͓rWjƎwԓR򊨛ZБx݊㉴sRśěۛɛƛțǛʛ˛̛ϛΛ͛՛ћЛқӛ֛כԛ؛ފٛۛڛܛݛBHIޛȌߛbJFЋsztȐёAX蛝y훋NKcHLݔXM{xɌNfpLf@CDB_FEAGHILJKMNUOٕPMQTU|VOo햷ʌWX^YJeZg[\]_`abSRc`FʍVjdeefޔihgaґmkjlk]ponqrzsOtJSKEuuYZzwyOxv|{|vӑ}}P~pbIxYߔ{Փfɐ҈ySđz䎷DӈŜƜĜǜÜȜɜœԑQT̜֜͜Μ՜ԜҜdSϜќԈӜʜМלc˜|Jڜޜߜܜٜ؜ݜeۜ蜧圜^ʐ@ABCYDEFՑˌߖ[GˍHőKILJM}NQZOVPc}RSWTRܐe┫ZcS]d_fba[YUXSِ`qg@hminAE\kwlˆgjUҔp}Jqsoߕ{̎~xPv|{uzrt@||̍TyڐT[wdf͒}~`KghrgېE̖TQPdBohi^FC[xǓĝq~ݝsŝǝƝU֓hȝG~ɝʝ˝|Đk֍l͝ΎΝҋːϝafzVН{ӝѝԝҝ՝֝؝םٝڝU|{۝ߝVޝݝՈ̐ftcE蝞WWNAӔiqŋɉgÈb\A@ܓBCjDFGHȋgXIJf֙]\֑ōLK񍽒LN]MNOؖ{DQpSVURTWLjލێZmXYۖ[\aYt^ܝnf`”f]cb͐їʉ}ged_͌kiˉgmsƑuAt^_ђMpoqnvljrhĎ`̒ȓhIxZz}ji͍{jyĈ|~ˋKjVO~[挜Bdǖ_IXoֈAŒ̓֒kȑ^퓾žƋ|ɋOyT|ҞP՞YԞӞОĞÞ֞ΞɞƞǞϞ̞\ƒʞŞȞl͞מߞ؞ޞݞΒ۞ٞWڞ➾͖~ўMk@ɓh@wKGFEBDCIELHJMQNOܞRSTUӋ~WVY\ԋ\[]̉V^`_abc~c΍defgihw}cjlBkmnopqsrtiuEkvaʚBwxꕈœyіz|{~}CXiÔ`Ĕ𓇟]rDדBv͉򐑔@AgDבjmÒk^FhlY_Q\CZO@ܗAUtƟҗßBişʟȟŸWɟğ˟̟[D~CǟYEύakПߟٟnԟݟQH֟͟ϟ`F۟Iӟڟ؟ܟΌÏXGҟN՟ΟџןpퟹanMJŖؑHBޟYRAВQ@NIRK઒HגkEDMGFLCKOPUTVYbSLWQZX][^aZG\`_JMdhfNObcgemmjilғnPoqprsΉD܎ЍQFutRxY{vzy_׈b}G~|wBTSకŏRďVWUƏϔώFonMYRӗzWCיZܒݎꖩuЕŔvĖSqҍ]Ɣ[\ό_ƓKTҖ—]LPQbl_ʋߊ`ωaXdbc]ǔfegihjԗՋilڗklmŠZ@ZABCDFGErIHnKJLMONQPÊr[RᶐYSpTcRb\jUV[YXEW؈Ȕ\Z{L^᪗l_]Ԕ`aoوfcbEidehgDa`^jklnmuvprt]usᾎoqaǏxwyzɒ|{s}~×ȕoᒔSpIFcHsqrtMu~mvᐓXῖĊՔږӖȏŊ^v“r˕uėᵖmZḋΐӍxuԍmCjv{yɏzd{VOqɕאm֔A@⁖CBʏDbFEGIH|ЎJV_FSPOcLNj_MKIˏ[ՍQRh֋\TSЉTUWXHYZ[׋щÓG\Hȉb]d`a≔`^_̏ڈHbcŐBdetŗgfilj҉mkemsoϐnnpqrntuv˓ސwy{xzA|Eq~M}⧗͏vG[^|ƊΏJ}yM؋}͕ӉZNJ\ߐ͔ѕzŽēUәȊАĕ̋HeSl⟊Ϗ⸐ЌWfƗnI@gC[RBюhAfaےFݗ׍GaIЏHIgDJEoMQ㋌LUiROPNKGWTVSpX㎑ea[_ۈZbfjԖԒ\dY]^㻈Ȗ]ًΗgchjmiҕɊɖ܈lknuovrȎtqwpcDks{~|z`ѐɔ}x@qJDUyJ[\Zʊߍrul딭rQA`HKˊ|sVlҎ㧎ϑkՖ^㮒EW㣔]яI̊Ҍbmnx݈_wّEӌE\ƐeҐrE]BAtDCorTHIGFJBڑNOKLMpUQGPSRcVWVXZ^[Y^\]d_`acbefgbh՗LvijPklmno介pqɎrsܕڊCwMtquʔwǑvDxzy|{}~͊ǗFŎHmcԉF|ڋۑcՉꋗϓpΖ։s䃒t`r׉Ί䜔eۋىҏ؍p؉ԌH专Gވ䎗t䟓䒑K䘕ӏN֖f䓑~uW䪖`H@̕UӒ@הԏǎBCnJPQDNFHRGKLOEEIFdOVTmSUWX[YZ˔M\a唑`Abh]_^PAdcefgՌsi|jklqrm\naopztwsuv֎x`ua{^|}~gؔIwXIډZIayOspXqՏt߈\܋Uܑьٍ啑T֏廐J]݋A@CBDPEFG漐vHeIJ橌KK`LoMO旗NePQRϊSTUVpWXYGZ[\]vu`_P^Lab׏cKݐidf؏ehigُ]frmwllkFlbYڏjopn֌_FsaUvrwtuqǓNۉbzxkЊyzȗ_{泒~|@}攏dyuӎwTދ戕xc]̝QJLؓۏ^eLvn݉̔ъӐ晒M惔ݑ\fGdGo^܏qw桑Ԑ͎q拕NzՐ׌HHxH@DABCJE֐GIFLRKMNQPOSRUTVWYXgZ[]^_\`ԎaORb]cfedygriڍhqkmjlpnPory֗SsAutx`wv{zyQ|}~DhCJ_ӕҒHIv}ߋԕމ痔Rqǒޑt秓r瀐ʒ笑秈AߑTi툝NٓxV^Օ߉繓BሦkyKՎJIɗҊWߓM׎@xYSsXsAѓUގz|珗Vy_XݏΔэߎ碗dʗB瘊jޒtݓbn،S甉ޏzge_LKNݕsee|K獐@BACыdB^EDF^tՒKbGHLJIߏOȒZMNLPVYXLQRUWZTS^_`]\[dbcaefhӊgsiljkmopqtruwvxMy•zJ[ՊԊ{|}~֊t}{ňhjɑ~Õ@w׊A’˗褗zG@Ku脌ۍBחꗯǐYWٌ蓎GԙJᐴ_뗋dkIPÐrʖvxCƈfڕ؊B蹉Cŕ{aДړ̗zjopz{犰^ޗڌ@BACDEFHGIHQJKZєOLݖM{a`NOPRSUQTيVWXYZ\[^a]_`bcd遍e]nfgyhʑwmljkiwnopqsrxtvRuxˑyz}|~{[@ETS@飖DBAC驕LNDEI~F邊khVLؗP–Γ鼓鰎DCEL@ABHQJGFKHG{LMNIOߒSTRQWPUVYX[\]hZ^J_`abcdefghki[jlٗmꞔnpqoꍍ˖sotuvKwٖxzy{|}~Cیl@Vs@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~X^u}~IIWVij{C|D^OPQRSTUVWXFGH`abcdefghijklmnopqrstuvwxym_nOQMobp`ʁPUabcdefghijklmnopqrstuvwxyz{|}~000 000@>?00000N0000  <^%"\& %      00;=[]0 0 0 0 0 00000 `"f"g""4"B&@&2 3 ! &&%%%%%%%%%%%; 0!!!!0" """""*")"'"("!!"" ""#""a"R"j"k""=""5"+","+!0 o&m&j& ! %!"#$%&'()*+,-./0123456789:ABCDEFGHIJKLMNOPQRSTUVWXYZA0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 !"#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO%% %%%%%,%$%4%<%%%%%%%#%3%+%;%K% %/%(%7%?%%0%%%8%B%`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$`!a!b!c!d!e!f!g!h!i!I33"3M33'3363Q3W3 3&3#3+3J3;33333333{300!3!!22222122292~3}3|3R"a"+"."""" """5")"*"NUZ?Ta(cY"uPz`c%nefh'Weqb[Y{b}}b|[^ cfHhǕOgN OMOOIPV7YYZ \`apafipOupuy}}ÀcUz;SNNWxNXn82z(/AQpSTTVY_m-bp TS[poS\zNx&nVUk;YSfmtBVNKO SU0[q_ ffh8ll)m[tvNz4[`풲muvř`iSQW0XDY[^(`cclopqYqq?s~vт`[iXeZl%uQ.YeY__be*j'kksV,Ğ\l{QK\aƁvharYNOxSi`)nOz NSNUO=OOsORS VYZ[[yfggLklkpsyykSkWl"ooEotuv wz{!|}6f̊Qeӗ(8N+T\]sLvT/Z__`hjZtxw^NɛN|OOPPIQlQRRRSSTTUQWW}YT[][[]]]x^^^^_R`Labbc;efCffmg!hhi_l*mim/nn2uvlx?z|}}^}}T*RLaʐuq?xMؚ;[RRSTXboj_KQ;RJTV@zw`ҞDs opu_`rdkNVdWXZZh`aff9hhmu:}nBNPOSUo]]]glstxP߈PW^+cPPQgT^XY[i_Mbc=hskn}pǑrx&xmye0}܃ dR(WPgjQBW*:XiT]Wx\OJRT>d(fggzV{"}/\h9{SQ7R[bdd-gkіv֛LcvRf NPSq\`dce_hqs#u{~یxefkNN:OO:RSSUVXYYYP[M\^+^_`c/e\[eeegbk{klEsIyy|}+}󁖉^ifnj܌̖okNrtux:y 3ꁔPl_X+z[NSW1YZ[`nouꌟ[{rPga\J~Q\hcfenq>y}ʎndžPR:\Sg|p5rLȑ+[1_`;NS[Kb1gkrs.zkRQSjT[c9j}VShT[1\]Oab2myyB}M~Frt/1KlƖNOOEQAS_bgAl ncs&~͑SY[m]y.~|~XqQSO\%fwzQ_eoikmndov}]uQR@bffn^}rfRSsY^_U`dPQR SGSSTFU1UVhYY~ d_xRbcBdb-z{v} INHQCS`S[\\]&bGbdh4hlEmmg\oNq}qez{}J~z9nΌxwMRU8o6qhQyU~|LVQX\cffZiruuyVyy| }D}4;a PuRSS PUXOY=r[d\S``\cc?ccdef]iioqNuvz|}}aIXlňpmPXaӁ5 OtPGRsSo`Ic_g,nO^\ʌe}RSvQcX[k[ \ dQg\NY*YplQ>UXY`Sbg5Ui@ę(SOX[\/^_ `Ka4bfln΀Ԃ.۞ۛNS'Y,{Ln'pSSDU[Xbbblo"t8o8QSSFOTjY1]zh7rH=j9NXSVfWbceNkm[npwz{}=ƀˆ[VX>_efjk7uNJ$Pw0W_e`zf`luznE{\uzQ{Ąyz6Z@w-NN[_bm6t4xFZuO^bcWeogvLr̀)M PWZhsidqrXjyw)/OeRZSbgl}v{|6f or~Q{rx{H{ja^Qu`ukQbnzvOpbO{zVYX䆼4O$RJSSS^,deg>lNlHrrsTuA~,酩{Ƒiq=cifjuvxC*SQS&TY^|_`Ibybbekluvxy}w^ۘ j8|P>\_gk5t w;gz9Suf_񃘀<__buF{ee gllp2x+~ހ *JҒlONNPVRJWY=^__?bfgghQ!}~2 T,SP\SXd4ggrfwFzRlkXL^TY,gQvidxTWY'fgkTiU^ggR]hNOSb+glďOm~Nban+osT*gE]{\[JnфzY|l wR"Y!q_rw'a iZZQ T}TfvY]rnMQh}}bxd!jY_[ksv}2Q(gٞvbgR$\;b~|OU` }S_NQY:r6Α%_wSy_}3VgS aalRv8/UQO*QRS[}^`ac gggnm6s7s1uPyՈJĖYNYON?P|^Y[^ccdfJii mnq(uzIɄ! e} ~ab2kltmmeg<ma}=jqNuSP]koͅ-)RTe\Nghttuψ̑x_szNceuRAmn tYukx|zOnae\NNP!NQ[ehmsBvwz|oҊ|ϑuR}+PSgmq3t*W`tAXm/}^N6OOQR]`s|}o#,BTojpŒ2RAZ^_g|iijmobrr{~KΐmQy2֊-PTqjkČ`gNNkhi~nxU _NN*N1N6NYzUYPYNYZYXYbY`YgYlYiYxYYY^OOYYYYYYYY%ZZZZ ZZ@ZlZIZ5Z6ZbZjZZZZZZZZZZZZZZ [ [[2[Z*[6[>[C[E[@[Q[U[Z[[[e[i[p[s[u[x[ez[[[[[[[[[[[[[[[[[[[\\\ \\ \"\(\8\9\A\F\N\S\P\O\q[l\n\bNv\y\\\\Y\\\\\\\\\\\\\]\ ]]]\]]]]]"]]]]L]R]N]K]l]s]v]]]]]]]]]]]]]]]]]]]]] ^^^^^6^7^D^C^@^N^W^T^_^b^d^G^u^v^z^^^^^^^^^^^^^^^^^^^^^^^^_ _]_\_ ___)_-_8_A_H_L_N_/_Q_V_W_Y_a_m_s_w_____________________`_!`````)``1```+`&``:`Z`A`j`w`_`J`F`M`c`C`d`B`l`k`Y``````````````````_````Maaa``a``a!a`` aaGa>a(a'aJa?acMcdOcccccvcccccckciccccccccccd4ddd&d6ded(ddgdodvdNd*eddddddddddddddd ddbdd,eddddedeee$e#e+e4e5e7e6e8eKuHeVeUeMeXe^e]erexeeeeeeeeeeeeeeeeeerg ffesg5f6f4ffOfDfIfAf^f]fdfgfhf_fbfpffffffffffffffffff?ffffffggg&g'g8.g?g6gAg8g7gFg^g`gYgcgdggpgg|gjggggggggggggggggggggggjhFh)h@hMh2hNhh+hYhchwhhhhhhhhhjhthhhhih~hihih"i&ih ihhhh6iiihh%ihhh(i*ii#i!ihyiwi\ixikiTi~ini9iti=iYi0iai^i]iijiiiiiiiii[iiiii.jiiiiiiijji kiiijijiji jjj#jjDj jrj6jxjGjbjYjfjHj8j"jjjjjjjjjjjjjjjjjjjjjkjkk1k8k7kv9kGkCkIkPkYkTk[k_kakxkykkkkkkkkkkkkkkkkkkkkkkkkkkllll$l#l^lUlbljllllll~lhlsllllllllllllllllllmM6m+m=m8mm5m3mm mcmmdmZmymYmmmommn nmmmmmmmmmmmmmmmmm-nnn.nnrn_n>n#nkn+nvnMnnCn:nNn$nnn8nnnnnnnnnnnnnnnnnAooLpnnn?on1on2on>oonozoxooooo[oomoo|oXoooofoooooooooooooooo p popppopptoppp0p>p2pQpcppppppppppppp qpqqeqUqqfqbqLqVqlqqqqqqqqqqqqqqqqqqqqq rrr(r-r,r0r2r;rsNsOs؞Wsjshspsxsus{szsssssssssttot%ts2t:tUt?t_tYtAt\titptctjtvt~tttttttsttttttttttuuu uu uuuu&u,uz7zCzWzIzazbzizpzyz}zzzzzzzzzzzzzzzzzzzzzzzzzzz{{ {{3{{{{5{({6{P{z{{M{ {L{E{u{e{t{g{p{q{l{n{{{{{{{{{{]{{{{{{{{{{||{{`||||{{| |{#|'|*||7|+|=|L|C|T|O|@|P|X|_|d|V|e|l|u||||||||||||||||||||||;|||||}}}} }E}K}.}2}?}5}F}s}V}N}r}h}n}O}c}}}[}}}}}}}}}}}}=~}}}}}}}}}}}}}~ ~#~!~~1~~ ~ ~"~F~f~;~5~9~C~7~2~:~g~]~V~^~Y~Z~y~j~i~|~{~~}}~~~~~~~~~~~~~8:ELMNPQUTX_`higxqܘ !(?;JFRXZ_bhsrpvy}Qۀـ݀Āڀր )#/KF>SQqneft_Ɂ́сف؁ȁځ߁ )+83@YX]Z_dbhjk.qwx~߂҂ނ܂ ق5421@9PE/+#|su΃؃  " 8m*(ALONIV[Zk_lot}:A?HLNPUblxz|bȌڌ  N͌gmqsύڍ֍̍ۍˍߍ B504JGILPHYd`*cUvr|ƎŎȎˎێ  &3;9EB>LIFNW\bcdڏ!  '659OPQRI>VX^hovr}Hbې20JVXceisrɑˑБ֑ߑۑ,^WEIdH?KPZϒD."#:5;\`|nV֓דؓÓݓГȓ6+5!:ARD[`b^j)puw}Z|~ʕoÕ͕̕Օԕ֕ܕ!(./BLOKw\^]_frlΖ˖ɖ͖Mܖ Ֆ$*09=>DFHBI\`dfhRkqy|z×Ɨȗ˗ܗOz 8$!7=FOKkopqtsĘØƘ !$ ,.=>BIEPKQRLUߙۙݙؙљ+7EB@C>UM[W_bedikjϚњӚԚޚߚ"#%'()*./2DCOMNQXtʛƛϛћқԛ:   .%$!0G2F>Z`gvx *&#DA?>FH]^dQPYrozĝƝϝٝӝuy}a̞ΞϞОԞܞޞݞv!,>JRTc_`afgljwrv/XiYdtQq~H܄Op1fhfE_(NNNOO9OVOOOOOO@P"POPFPpPBPPPPJQdQQQQRRRRRSS$SrSSSSTTTTUYWeWWWWXX YSY[Y]YcYYYV[[/u[[\\\\']S]B]m]]]]!_4_g___]````` a`a7a0aabbc`dddNeff;f f.ff$fefWfYfsffffffg)fggRhghDhhhiii0jkjFjsj~jjjk?l\llollmmommmmmmm9n\n'n?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWp!q!r!s!t!u!v!w!x!y!`!a!b!c!d!e!f!g!h!i!12!!!5"~H܄Op1fhfE_(NNNOO9OVOOOOOO@P"POPFPpPBPPPPJQdQQQQRRRRRSS$SrSSSSTTTTUYWeWWWWXX YSY[Y]YcYYYV[[/u[[\\\\']S]B]m]]]]!_4_g___]````` a`a7a0aabbc`dddNeff;f f.ff$fefWfYfsffffffg)fggRhghDhhhiii0jkjFjsj~jjjk?l\llollmmommmmmmm9n\n'n!=!F!G!H!I!w"x"E!D!s"l!m!("n!b-d-r"5-6-7-8-9-:-;-<-=->-+","*"-"M"N"O"_"P"`":";"t-e"g"g!x-\"B!J"K"A"@"i"j"s-h!h"f"b"b!a"e!f!c"d">"?"<"="]"y-!-"-#-$-%-&-'-(-)-*-+-,---.-/-0-1-2-3-4-!(,("(-(#(.($(/(&(1(%(0('(<(7(2()(>(9(4(((8(=(3(*(:(?(5(+(;(@(6(#"""%"$"'"&"!"~!{!}!|!z!y!j!i!v"u"t"!!"!#!7!9!:!;!R!S!T!U!V!W!X!Y!Z![!)"."L!M!`-a-!$"$#$$$%$&$'$($)$*$+$,$-$.$/$0$1$2$3$4$5$6$7$8$9$:$;$<$=$>$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z$[$\$]$^$_$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$+!,!5!6!!%"%#%$%%%&%'%(%)%*%+%,%-%.%/%0%1%2%3%4%5%6%7%8%9%:%;%<%=%>%?%@%A%B%C%D%E%F%G%H%I%J%K%L%M%N%O%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s%t%u%v%&!0;e><2TI?M"P/1n3#P$@BRV5:Jg>>NBJ$PfC%Pz6&P]40Cg<'P(P)P5GW57GcFC83KIi*Ph>+P52e6p8iL&VpM}F%455,P-P;N=MhA/Pv;sF2P>1_8^8f0KOJO3:!03P4P5P4K6Pr8g0rK|5}5~5bDPB?PUIg@8!@PBPeBaNJ0AP>2D6gCo7CP$Gk4DPK0`8l4zI2HY5q2gPAElGFPMEPGPn:HP$UPPSPQPB2;JKPOPs8H;&4TPLPcNx;MPRPUPNP!6M0"6A2%UyKnIt8/?7NXJ87%Bd2S=YP^P\PWP/BZP]P[P]JXP.?sK_P`P$=mPPG6IhPpJ62lPfPoPRAD8\GG`nP]EcPv8u8aPZ<iPoJMCePq7bPjPdPQNkPAOf6p7pPqPuPN0PJtPsPwPvPdDr7xPE<&BeDv6yP65zP|P5Kf71;wH{PE:CM~P#Q}PD:}=97$QO6!Q"Q/F|A#6MK%Q=N&Q)Q'QNA(Q*Q,Q+QHJ75.Q/Q/2-Qt<2Q1Q0QVP3Q~=4Q%MYL6Q5Q8Q7Q9Q:Qt058;7<={C$6h@w8n9Q~F4A@QAQ,Hx8;OBQ&6L<'4OQMQ=LNQZIPQQQRQ_EVQTQUQSQc:WQjLdNXQ(@YQZ=ZQ|C?N`EER[Q%tE6\Q^Kh=|B^QdF_Q`Q.3aQ'6LFz1P=!HbQaEO?cQ,JZ@"4)4dQfQ:7eQsNi==HLJgQxMhQiQ~EjQ)@~:t7kQI;o9fDmQ'Bo:nQoQ0AlQqQ6Kd9pQu7^:mGtQrQ{Ij>{Qd3uQsQOAwQvQD3`7|Q-NxQ}QzQyQONy8C2tNu=XEe9"R#ReN+O%Rz8$R/3&RVK)RgJ-R*@*RP6+R+4.7.R/R0R1R[<{8^LhLwFqJ2R3R5R7R6R8R=2LK|:9RYA">)6:R[H;RR$Ih6e0?F?R==i@AR@R#>a8CR>HDR\H4BnB(6nF1CnGNKFRj@57GRHR,1u0m4(BQ5qMKR72JR*6LRqLMRRN|868NRPROR_?91^1QRRR78SRn52;TRtK5:Z5'MPA?H}<G=h\RZRD2fB8L!9yMGE~8/7gRc6JK]HfR^4aRbRdReR[5a?-JcR_Rc8`R$OrJhDb8p9hR]FlR~<v<oRmR#LjRsRnRqRF8?LrRtRvRp:BOkRiRuRpRxR#SzR~R!S{R>Si:13yR%Sv0$S%0JI"S|RwR}RH:&Sw0/S'S(S%>iK-S,S/E.S+S416:0?)SbE*S"04S#M'>:S9S0SCB1SoB6S&>3SdL<77S8S5S;S2SASFSBS=SGS1AIS"9?S}CCS31WS^2bS|>^S\S]S_S=19AYSZSz3aSo4dS`ScS.JUF8HfSeSE3gSjSiShS9GkSlSnSmSpSsSqSoSrStSuSvSwSxSEQ|?T@T>TBT8Gh0VICT}>9<]Gp4k:YK2Fx7OBATDTDBETFTHTiD.4!ta1sJl>HEf:NT=J]Nt2JT:AMTcEIEdE9HMDI:ITv16EKTGTP?OTN=-6PThJ}AFDRTOKSTXT/JWTQTTTVT&:IJYTECu2m>[TZTh9\T^T]T`TUTbTaT_TN;Q?TAcT<@m0dG[DeTdTfTgThTiTQJjTF2kT~T%C}T3Jw=[E!U%9"U!G^HQL%G+U85EM/L,V#U&UEB8KJE'UeKJ:*>(UP;O;90H8+@Q0,U-U*U81/4)UEL1I(0y0Q;R0#02U0U4U,OLG6U':9UXI:U5U;L^G;U2IUy7LUEUBUdCAUCUDUFUGUr4IUHUJUn>MU\DE1KUNUOURUPUQUR;SU&9TUz;8BUUVUZ;'9RL(5I8WUX3XU9BYU#VZU[U\U^U_U`UpB'1iH2bUFMI=drUsUS0:BR?tU3F.>/>uUm@0>vUwU`LxUF6"=yUzU\<,?tFT?xH"GI6{Uo5|U~6OF02S;}U"V!V}6~U8E0BKEH<XAzM$V%VVF3;'V(V)Vt4*V+V,2;Ad4-V(LRBY3/V1V_4.V0V3V2V4V5V=F.6e26V;V9VwJvJgE8VT=7Vr?VGVFVEVAV@VDVxJKVHVJVrMIV?Vs?LV7:MVNVQVPVOVhE:VWVSVRVTVUVXVfNYVVVZV`4[V]V\V^V_Vn@#=d=cA)98:*9p5`V9:J8aV&LCGbV+9,4'CR6T;[IAHcVu4fV!DeVdVgVkDc?U;J@SB"5"DhViVo>9KlVkVjV}IsVZKmVoVkKnVpV(HqV>JrV34?J/GtVuV,944vV88DM)Mv4xV#D-91>_H2>x=lDyJ9E.9\IyVYEB:K8mDC0n=/9GMzV{VQG|VwN-O~V}VG3!W$W%W#W@I3>'W&W"W(W)W*W-W+W,W.Wd1nD/Wz7v26G0W{F[J1W.O2W@J5W!P1P0W@WvEAWBWCW4W3WDWA7'IL:7I&DKIEW4>F1FWGWrL`HJW}1,@IWHWB7TBNWLWKW'Ne8y=MWLE>=@FQWPWOWRWf8SW|I[=TWyHAF'D0EUW+54?,Iw4&GVWV;:K;K~1[WiCXWw2-XZW0GYWWWz9]WcWiWaW\EfW]I`WeWgNW;UB^W^5hW-@e1bWx2gW16dWjWlWvWtWqWpWxNrW2619z=yWkWoW_Wz2sWuWQC(:82mWxWwW36)Bf3C7nWzW}W!X=<'XpD{W%Xy2#X$X~W"Xg8*M54Y1&X:G-0aH\W,X0XeL)XiE.Xp>/XWFGO+X1X{9K@T0*X(XZA|W4;FB=X[A8X5X6Xf<9XX?XU03Xr6&064;XCXBXGXHXFXIXAXEXJXKX@X|;DXVB292X5?XXiJNXOXPXWXVX}K74TXE743QX8NSXV0UXLXRXYXD7MX]M+M\X`X~AyNaX^X[XZX_X0J4FF7bX]XcX{712kX84iXjX):hXfXeXlXdXnX{2pXoX(DsXqXgX|7rXvXuXwXtXxXyXzXjJ|X{X?=.@f2|2}X?0L@~XCl!Ya7"Yo@#Y$Y:5%Y&Y'YWBM8aL;50Y7Y6>1YDG^M3Y4Y8YjE5Y39^@FY4HrBdH-ZzJqDuK;Y!2jCDY4C>YEY@YGYCYBYoGAYRGr5H3g3!?IYNYJY}7OY";i9&==Y};LYX;MYD0HY)Ds546KY'0C:6?rDTHQY^A*B+;RYTYPYaJ=D\A{JN<`Y_Yx?~7YY9>hF1GWY]Ax<\Y8>VY[YSGUY!7]3]Y+NN:5CZY\@59d?f15Z9Z7Z8ZpY;Z:ZxYZ@Z?ZAZ~269|J/@N8CZFZRI_5EZDZTGGZ56IZHZ:46;XFI7t?JZ0@(E_IKZLZMZ8J]UF@LIX:eHCHMEANOZP<PZ60T6M@`IQZB;GC[;7?RZ}Jw1\;UZSZVZ9NTZ{@WZ2BXZz4ZZYZ[Z\Z{4|F6Cl5];aA\=00]Z"2aZ79`Z+::>_Z;>@L*:W0N@fZ1@G1U=fKr:<>'@eZcZdZkC&[jZ~;89hZiZ8?gZ/;lZkZpZqZmZ"3nZoZUHaIJ7rZ2@=>RCG6sZwZK2tZvZuZk=HCE0xZyZ*DqNC;kJ=K"[{Z~Z}ZzZ![^F|Z#[l=$[KMxG%['[([)[J6H199*[+[q=bAXR>A=AXBG:rPn7-M~J~I,[s:?D-[/O>K+D.[|4/[0[ZL$LvK\K%;2[k<QK4[7[6[y4`53[5[8[y?{MI0`:;[NE9[+B:[r>]L<[=[hMB[:9UG?[lE^ZbZO5GGA[>>DHG[zH>[D[C[O@mKSNgKL2^;HOF[u?E[@[O8L[J[M2H[N[T[HBAJV["IU[pG?K;4w@@=SD.MQ[P[R[O[W[M[K[S[I[lCxLFmTh8|Mh[tD#3-:`[p[a3n[r[nE~42\ILw[}4~[@K!\#\'\y[*CoE+\|[(\"\9?,\3@*\=4POv[&\X0x[:L}["?GDs[%\z?/\q3!81\z[0\)\{[-\.\?\NF$\;\=\XDLMvI8\JB>\?A5\B\A\oF@\jFD\7\H6:\]=`G<\K64\6\3\0OZ39\C\53g:]1T\1OW\:?V\U\R\F\c\E\X\P\K\H\I\Q\"tN\=9HDdAL\G\J\MMjKO\Y\a\Z\g\e\`\_\PDeA]\[\b\h\uHn\i\l\f\tC8I\\d\@>OLx\k\"8#2_3S\A>p\w\y4=]<]>]N27C?]?4A]@]B]C]D]_;5@!:pIbJDOu;P:rNE]F]`;G]H]J]I]XK^=l9SCi]q]j]ABb5r]h7%5p]n]k]`M@DYFl]t]s]#7-2;:m]o]WKtBwK|]}]O2(J}L!^#x]~]h176u]z]t@qGgHw]!Ky]$^"^{]"KHGc5%EmC%^#^YBv]K1NM0^/^v@,^lM6F&^EDL1?9)^'=.^-^(^+^h3*^IG.Nt>u@6^4^MI1^3^:1@92O=3bIaM$3;?5^:^C>0M7^2^8^^NsEBF63U1>^A^CNdMH^B^?^TNE^J=G^L^qEJ^D^8CK^@^F^M^|0C^N^=^B=L7<^R^m=:8a^[^t5OEV^_^/02192X^,BO^Q^A9b^]^U^\^+LZ^^^P8E>9CT^/MW^P^rES^Y^QO><~Kc^.Ho^;8`=e^/NB9r^n0p^d^j^l^OMg^.Ei^q^k^GLf^"<~^j3h^m^n^lBZBv^|^z^)E#_w^x^`^y5:I?<w93Ot^"_i1fAyGA4zN!LRD{^}^2A!_y^s^C4i7/_*_x@c3a=3_,_,D)_YDL_&_%_._(_'_-_!@$_0_1_B46_5_7_:_CE4_8_c7yB2_;G9_>_<_?_B_;_j9(G9^tM=_A_uB@_+_ioE_I_G_C_D_H_F_NIN_K_J_M_TFO_uCmB%@P_R_Q_u^S_gFT_P2tE%3d5^3AF>{Nj_y@f_k_l1i_aGe_h_H>QHl_Q<z@o_g_'7m_PMp_&tO=q_r_.Gt_u_3GuEw_y_UNv_x_m1s_[Sz_gA8;|_{_$?YR}_!`n_~_"`zG#`$`%`&`^D(`'`)`*`_59`:`$8HH<`u>;`86=`?`>`@`Q8A`i6@A}9C`D`B`m<HF96F`,CE`5ObGI`K`H`TLJ`L`DNP`O`vC-G%8N`M`1M2MQ`n1v9b;R`S`U`C=W`V`X`M3Z`Y`\`[`<8(NL6&2j6a4hN^```a`Q2]`9;AD_`d`n<b`>7IHc`~`i`=8e5f`}M0NvBh`j`VNW6|HJGk`m`p`l`o`j8M1q`p?n`\Nt`$tr`u`g`s`<:v`w`~Mx`y`e`z`D4%<{`|`}`;1!a;I"a$4#a$a%a'a(a&aSI*a)a,a+a-a.a0a/ay92a1aE4S?aVHAaBa[0v>GaDamFCa&5JaEaFaIaHa%IBAAA?5KaLaMaOaNaV1WahHQaSaUa>?VaTa@<PaRaBII>YaXaZa&DjA=bb=J>@b?b>b}HG4)8FbCb??2LBbDbEbAbGbHb/Dc4eCIbJbMbg?DFNbSKKbLbQbPbObSbRbTbVbUbMJV=FNWb7FXbYb]b[b\bZb^b_b`bab7LbbpLcbNCjGk6;Cdb:6P@eb=:fbgb&8U:ibVEV:N5$KKGWE\9kbK>2NE9'8#Hmbobk8nbvDqb73lbjH01l:ROpbrbKJY@tbubsbN3{bzb'<|bwb}bxbXHvbyb"c!caK~bk0$c#cL>%cCA'c&c(chbjb*c)c(<iNR<+c77@5'5c;4M1c0cDA-c/cK=@?.c,c*GM>ckHEAAcBciGA??caC@cN>\0)5CcxDDcG@-L#IEcFcUCGNHcGco<Jcp0McKcT2N7LcF9r9fJNcTKPcQ@O1:2,0OcQcRcw>ScO3Ucj7f5Vcu6Wc|@MF`@u:XcbCkAZc\cYc[c"7]c&7g5RM_c`c.1ccv3bcacec^cfc)NgchctTjcickclc5NmcopO>ncocW=8Fpc(Cqcxcyc+Ezc^3Z?dI|chBwc{c}c{:&d.I&HyEZ6%d#d5H~c^C{EzEv:8d(d*d-d.d+d,d)d'd!dOJU25d2d7d6dsG'L;;0d9d4d3d/d1dI4=C}@"H>d$Ha@;dOH?dSJ[C:djdhdfdndmdldkdodpd:@qdsdrdR88Aud|Etdvd5JlAG9wdHNydzd{d|de;}dO7j5*5!esLH9~d$efL0:)e*=>8HA%e+e&eP7.e2ek7-e6eJ9mM<03ek50e1e}E/e,e(3d@(88e5e7e4eQ73B9enAFeBeC?e=0JL>e[6lHmAPNo=neHe~@DeIeKeyDNeJeTJK4KL^0Me}NLeo1lFOeVePeWeSe{GJf;fO)HkfS>*IlfjfN4T8h;nH*8CKofmfN9O9i0h:YG_0tf@CXG[Bvfrfufpfsf&KU8}0qfxfyf9F;6&g=Gi;<6H@FO.LwfT@S5zf|f{f}f&C>G1D#g"g~fU?eI%g$gP9SO5g)g*gp<(gx9'g+g2D"J#A\B/g0g,g-g.gQ96g2gfIlK(I1g4g3gDK7g8g7A9g;g?gg22Eg@gAgBg!BDgCgFgGgHgC?i2IgWN+<-=j;WCJgKg11LgMgNgOgPg=6*ZQge@RgK<Sg0PTg^J\4$AX=qI.=UgR9VgLHdgXgIBuG?8Wg%AYgzD[gZg]g\g^g`g_gO4agbgcg1:INeg'?p1fggghgr0igjggIG<lg)320kgngNGD?V2'K]7\6mgj2#4q1rgjN]BDI~gW2|gzgqgogpgch0h|GiM9hOhGh{?F5]6Bh[2T>EhZ:QEJhnJAhZ2V8)IKh?hHhRhChDh:FIhFh(KLh`0@hNhMhkGTh_h~3bhPhUhnM^hUM*NxCk3rIdh!F10]hYhrASh[h`h,G*0XhahxI\hWhU>/=,<XLGIghphZhw3x>ehjhsAfhmh_CnhVMch83ihlh,Lohhhkh)K!OshzhrhC<QhNJ"Lyhxhthuh61whqhUDvh~0"BCJ{h!iYH~hV>I<#i>6$iyI}hVh|hOO"FsI+i1i2i%ivG/i'i)i3i(i,ir1eF-i0i&i&A*i';E?07tLyLr=7i5iNO4iuM6i8i9ii@i?i1]"]EiDivMj@j?jBjAjZiFjCjDjEjGjl7IjHj0=T9'^JjQ=93KjR1W>LjU9Mja0=INjj?UjRjoCSjPj^6OjVj67^B\jXj5BWjZjQj[j]joHYj^j`jS8TjA0_j[:vNajbjuA"Ncj5MdjejdJfj@:#NkjljX>jjgMgjij=@~?hjmj#Jojnjl3+Kpj|jrjsjtjujyjzjxjvjqjwj{j7p(2~j_6}j"k!k$k#k%k1=&k'k(k>@WM)k$JFG*k+k+8,5,kk;AG-kP3.k0kwM/kF?1k2k3kQ44k5k6k7kQ38k9k:kr2(?;kkW7V?Ak$F@k17?kwB-5BkCkY>m7Dk,K_@v5uLJAEkG?pCZ>FkIkJk>:BBHk[>>IGkl;S1NkX7n;m;MOMkLk'AM5CO:3\>KkPkQkOkX8@Mo;'GTk@@BC6MWkl8?@SkXkm8UkVkRkb@IF/C]2pHC54D[kYkLCA@R4Zk[?JN@O\kgk5Dfkckkkdk`k|D_k]k!Mp;ak^kekt=A8zBEKZ1b0%FikhkfFmkbklknk,8jkV9U<okXMrkuksk5Ipk`6tkvkzkwkykxk{k1<}k|khI!lY7~k"l#lD5Afy>$ln8%l&l>;NZ'l(l2=)l*l+l,l-l+C.l0l/l&F1l-K2l3l4l5lZF]>6lk9.P7l8l?I9lAl:ll?l@lBl-3gDiIb:W9OI_2NHElS4U@DlIlyCcLGlHl.5JlcG_BqH=EFlGKl2Ll(OBDEOq;Kl1B\l(AxFPIOl?;r;^>eG-8NlMljIA<REQlRlX9PlSlTlVl#BUlf4XlWlYl[l]l^lV@O<_lR3`lvAalblkI/5cl6D[1dlq<v?-Bglflelmlklhljlilllw5plW@qlY8nlol)O7D)ArlulsltlYM'Fxlvlwlyl)m|l}l{lzl}D!m%m"m~l#m$m+m&mX@(m*m'm-m3=,m.m/m2m1m0m4m3mvL6m5m7m8m:m9mH?;mm6m?m@m=mAmVEDmGm4<FmEmZ7HmS3Jm\:ImRmLmNmeJKmMmQmOm15PmSmZGXN4=Tm"MVmUmYmAMXmm3Wm\m[mZm2E]m^m_ml9%7`mambmI?cm-n47;nRnPnQnTnSnz>UnVnWnPHS:a[9HKd6F="o$oS6EIb<#O~nx:?O&o%o'o}niFUEWD,oCC(o)o-7+o08*oa>y30o?:yAJD;3.o/oCD-o1o7o:o9o-E2o3o6o8o@6;o5o4o?o@oAo>o=ob>*F#1YN+p.n*p.p,p-p/p0plN1p2pI@;H}?g4:Mm28=[85p4ps;6p3p(;:p-jVRw?8p%NqF+1c@6<7J@1mNkM;pEE{<pnN9p@pBpAp?pCpDpzAb2Ep8LFpGp*O1[HpIpJpNpKpLpMpOpD@wLE@PpsHQpSsLLRpSpTpW3VpY?Wp$7Xp\pZp[ps3Yp]p^pH0_p`pd>apG5dpcpbpqk\JepfpgphpipjpZ4kplp#Gnp;2qppp$1A6GJ:D":`9g=\?sprpBMh4RH\F|?NN[7vpupKK,FP1wptpQIjMxpyp{pjB[3\3zpi428j4?E`N\8|p}p~p!q#q"qwI$q%q&q'q)q(q*qtHLf)?25+q,q,R;]SH{0;0t;0K~>-q_L.q\MB1A;/qn20q1q3q4q6q2q5q[47q8q9q:q;q=qq@qAqCqB6s3OGGqHqZCkFIq}GLBX1n6o6sCNqp6o2MqKqLqJqXqOqPqQqRqTqSqY=UqWq35Vq{A38YqMBZq-F[q`q^q]q_q\qbqaqdqC6cqeqfqhqgqiqkqjq|9lqmq<3nqoqq?pqqqrqsqb9tquqvqwqxq1Hzq&I{qyq}q|q~q!r"r#r$r%r&r'r(r)r*r+r,r-r.r5]/rxd45!32:1r0r%L3r4r2r5rbK6r{5%O7r9r>0:r+J8r;rr?rnK-;z:/A@rCrArDrq8BrErFrGrKr*;dBLrIrHrJr_7PrOrNr30ZrVrWrSrYrUrb3LOXrTrRrQr\r_r^r]rII[rs0`rbro3Mr71drcrar-CpKZNerfrgrhrir;Djr7Horkrlr1KDLPFprqr>Fnrmr*2yrxru1vrursr{3rr2<)2c9|r{rzrwr}r~r%s$s&s-1!s"st99L#s2K+s's,s)s(s\7-s.s/s*str0saD4s5s3s2s8s1s6s7s:s9ssIO;skBm:?s@sAsBsCs48DsEs/<FsGsHsIsLsJs*>+$)D)G*G+E*E+F*F+D*E)&)F)H*H+I*I+G)J*J+L*L+K*K+))I)()H)M*M+O*O+N*N+J)+)K)W*W+V*V+-)M)Y*Y+[*[+Z*Z+\*\+]*]+_*_+^*^+a*a+`*`+/)O)l*l+i*i+f*f+k*k+h*h+j*j+q*q+t*t+s*u*u+w*w+v*v+&*&+C*C+U*U+g*g+p*p+m*m+o*o+n*n+0"/"2"6"5"3"8"9"a&b&c&d&g&i&l&v&e&j&q&r&s&t&{&x&u&z&w&y&|&B'C'D'E'F'G'H'I'J'K'L'M'N'r's't'u'v'w'x'y'z'{'|'}'~'sstsusvswsxsyszs{s|s!0"0#0$0%0&0'0(0)0*0+0,0-0.0/000102030405060708090:0;0<0=0>0?0@0A0B0C0D0E0F0G0H0I0J0K0L0M0N0/tO0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0_0q0r0s0t0u0v0w0x0y0z0{0|0}0~0!1"1#1$1%1&1'1(1)1*1+1,1-1.1/101112131415161718191:1;1<1=1>1?1@1A1B1C1D1E1F1G1H1I1J1K1L1M1N1O1P1Q1R1S1T1U1V1W1X1Y1Z1[1\1]1^1v1_1`1a1b1c1d1e1f1g1h1i1j1k1l1m1n1o1p1q1r1s1t1u1w1x1y1z1{1|1}1~1!2"2#2$2%2&2'2(2)2*2+2,2-2.2/202122232425262728292:2;2<2=2>2?2@2A2B2C2D2E2Q20tF2G2H2I2J2K2L2M2N2O2P2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2`2a2b2c2d2e2f2g2h2i2j2k2l2m2n2o2p2q2r2s2t2u2v2w2x2y2z2{2|2}2~2!3"3#3$3%3&3'3(3)3*31t+3,3-3.3/303132333435363738393:3;3<3=3>3?3@3A3B3C3D3E3F3G3H3I3J3K3L3M3N3O3P3Q3R3S3T3U3V3W3X3Y3Z3[3\3]3^3_3`3a3b3c3d3e3f3g3h3i3j3k3l3m3n3o3p3q3r3s3t3u3v3w3x3y3z3{3|32t}3~3!4"4#4$4%4&4'4(43t)4*4+4,4-4.4/404142434445464847494:4;4<4=4>4?4@4A4B4C4D4E4F4G4H4I4J4K4L4M4N4O4P4Q4R4S4T4U4V4W4X4Y4Z4[4\4]4^4_4`4a4b4c4d4e4f4g4h4i4j4k4l4m4n4o4p4q4r4s4t4u4v4w4x4y4z4{4|4}4~4!5"5#5$5%55t&5'5(5)5*5+5,5-5.5/505152535455565758595:5;5<5=5>5?5@5A5B5C5D5E5F5G5H5I5J5K5L5M5N5O5P5Q5R5S5T5U5V5W5X5Y5Z5[5\5]5^5_5`5a5b5c5d5e5f5g5h5i5j5k5l5m5n5o5p5q5r5s5t5u5v5w5x5y5z5{5|5}5~5!6"6#6$6%6&6'6(6)6*6+6,6-6.6/606162636465666768696:6;6<6=6>6?6@6A6B6C6D6E6F6G6H6I6J6K6L6M6N6O6P6Q6R6S6T6U6V6W6X6Y6Z6[6\6]6^6_6`6a6b6c6d6e6f6g6h6i6j6k6l6m6p6q6n6o6r6s6t6u6v6w6x6y6z6{6}6~6|6!7"7#7$7%7&7'7(7)7*7+7,7-7.7/707172737475767778797:7;7<7=7>7?7@76tA7B7C7D7E7F7G7H7I7J7K7L7M7N7O7P7Q7R7S7T7U7V7W7`7X7Y7Z7[7\7]7^7_7a7b7c7d7e7f7g7h7i7j7k7l7m7~7n7o7p7q7r7s7t7u7v7w7x7y7z7{7|7}7!8"8#8$8%8&8'8(8)8*8+8,8-8.8/808182838485868788898:8;8<8=8>8?8@8A8B8C8D8E8F8G89tH8I8J8K8L8M8N8P8Q8O8R8S8T8U8V8W8X8Y8Z8[8\8]8^8_8`8a8b8c8d8e8g8h8i8j8k8l8m8n8o8p8q8r8s8t8u8v8w8x8y8z8{8|8}8~8!9"9#9$9%9&9'9(9)9*9+9,9-9.9/909192939495969798999:9;9<9=9>9?9@9A9B9C9D9E9F9G9H9I9J9K9L9M9N9O9P9Q9R9S9T9U9V9W9X9Y9Z9[9\9]9^9_9`9a9b9c9d9e9f9g9h9i9j9k9l9m9n9o9p9q9r9s9t9u9v9w9x9y9z9{9|9}9~9!:":#:$:%:&:':(:):*:+:,:-:.:/:0:1:3:4:5:6:7:8:2:9:::;:<:=:>:?:@:A:B:C:D:E:F:G:H:I:J:K:L:M:N:O:P:Q:R:S:T:U:V:W:X:Y:Z:[:\:]:^:_:`:a:b:c:d::te:f:g:h:i:j:k:l:m:n:o:p:q:r:s:t:u:v:w:x:y:z:{:|:}:~:!;";#;$;%;&;';(;);*;+;,;-;.;/;0;1;2;3;4;5;6;7;8;9;:;;;=;<;>;?;@;A;;tB;C;D;E;G;H;I;J;F;K;L;M;N;O;P;Q;R;S;W;U;t7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=?tn=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=!>">#>$>%>&>'>(>)>*>+>,>->.>/>0>1>2>3>4>5>6>7>8>9>:>;><>=>>>?>@>A>B>C>D>E>@tF>G>H>I>J>K>L>M>N>O>P>Q>R>S>T>U>V>W>X>Y>Z>[>\>]>^>_>`>a>b>c>d>e>f>g>h>i>j>k>l>m>n>o>p>q>r>s>t>u>v>w>x>y>z>{>~>|>}>!?"?#?$?%?&?'?(?)?*?+?,?-?.?/?0?1?2?3?4?5?6?7?8?9?:?;????@?A?B?C?D?E?F?G?H?I?J?K?L?M?N?O?P?Q?R?S?T?U?V?W?X?Y?Z?[?\?]?^?_?`?a?b?c?d?e?f?g?h?i?j?k?l?m?n?o?p?q?r?s?t?u?v?w?x?y?z?{?|?}?~?!@"@#@$@%@&@'@(@)@*@+@,@-@.@/@0@1@2@3@4@5@6@7@8@9@:@;@<@=@>@?@@@A@B@C@D@E@F@G@H@I@J@K@L@M@N@O@P@Q@R@S@T@U@V@W@X@Y@Z@[@\@]@^@_@`@a@b@c@d@e@f@g@h@i@j@k@l@m@n@o@p@q@r@s@t@u@v@w@x@y@z@{@|@}@~@!A"A#A$A%A&A'A(A)A*A+A,A-A.A/A0A1A2A3A4A5A6A7A8A9A:A;AA?A@AAABACADAEAFAGAHAIAJAKALAAtMANAOAPAQARASATAUAVAWAXAYAZA[A\A]A^A_A`AaAbAcAdAeAfAgAhAiAjAkAlAmAnAoApAqArAsAtAuAvAwAxAyAzA{A|A}A~A!B"B#B$B%B&B'B(B)B*B+B,B-B.B0B/BBt1B2B3B4B5B7B6B8B9B:B;BBCt@BABBBDBEBGBHBIBJBLBCBFBKBMBNBOBPBQBRBSBTBUBVBWBXBYBZB[B\B]B^B_B`BaBbBcBdBeBfBgBhBiBjBkBlBmB?BnBoBpBqBrBsBtBuBvBwBxByBzB{B|B}B~B!C"C#C$C%C&C'C(C)C*C+C,C-C.C/C0C1C2C3C4C5C6C7C9C:C;CC?C@CACBCCCDCECFCGCHC8CFtJCKCLCMCOCNCPCQCRCSCTCUCVCWCXCYCZC[CIC\C]C^C_C`CaCbCcCdCeCfCgChCiCjCkClCmCnCoCpCqCrCsCtCuCvCwCxCyCzC{C|C}C~C!D"D#D$D%D&D'D(D)D*D+D,D-D.D/D0D1D2D3D4D5D6D7D8D9D:D;DD?D@DADBDCDDDEDFDGDHDIDJDKDLDMDNDODPDQDRDSDTDUDVDWDXDYDZD[D\D]D^D_D`DaDbDcDdDeDfDgDhDiDjDkDlDmDnDoDpDqDrDsDtDuDvDwDxDyDzD{D|D}D~D!E"E#E$E%E&E'E(E)E*E+E,E-E.E/E0E1E2E3EIt4E5E6E7E8E9E:E;EE?E@EAEBECEDEEEFEGEHEIEJEKEMELENEOEPEQERESETEJtUEVEWEXEYEZE[E\E]E^E_E`EaEbEcEdEeEfEgEhEiEjEkElEmEnEoEpEqErEsEtEuEvEwExEyEzE{E|E}E~E!F"F#F$F%F&F'F(F)F*F+F,F-F.F/F0F1F2F3F4F5F6F7F8F9F:F;FF?F@FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZF[F\F]F^F_F`F6GaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrFsFtFuFvFwFxFyFzF{F|F}F~F!G"G#G$G%G&G'G(G)G*G+G,G-G.G/G0G1G2G3G4G5G7G8G9G:G;GG?G@GAGBGCGDGEGFGGGHGIGJGKGLGMGNGOGPGQGRGSGTGUGVGWGXGYGZG[G\G]G^G_G`GaGbGcGLtdGeGKtfGgGhGiGjGkGlGmGnGoGpGqGrGsGtGuGvGwGxGyGzG{G|G}G~G!H"H#H$H%H&H'H(H)H*H+H,H-H.H/H0H1H2H3H4H5H6H7H8H9H:H;HH?H@HAHBHCHDHEHFHGHHHIHJHKHLHSHMHNHOHPHQHRHTHUHVHWHXHYHZH[H\H]H^H_H`HaHbHcHdHeHfHgHhHiHjHkHlHmHnHoHpHqHrHsHtHuHvHwHxHyHzH{H|H}H~H!I"I#I$I%I&I'I(I)I*I+I,I-I.I/I0I1IMt2I3I4I5I6I7I8I9I:I;II?I@IBICIDIEIFIGIHIIIJIKILIMINIOIPIQIRISITIUIVIWI.tXIYIZI[I\I]I^I_I`IaIbIcIdIeIfIgIhIiIjIkIlImInIoIpIqIrIsItIuIvIwIxIyIzI{I|I}I~I!J"J#J$J%J&J'J(J)J*J+J,J-J.J/J0J1J2J3J4J5J6J7J8J9J:J;JJ?J@JAJBJCJDJEJFJGJHJIJJJKJLJMJNJOJPJQJRJSJTJUJVJWJXJYJZJ[J\J]J^J_J`JaJbJcJdJeJfJgJhJiJjJkJlJmJnJoJpJqJrJsJtJuJvJwJxJyJzJ{J|J}J~J!K"K#K$K%K&K'K(K)K*K+K,K-K.K/K0K1K2K3K4K5K6K7K8K9K:K;KK?K@KAKBKCKDKEKFKGKHKIKJKKKLKMKNKOKPKQKRKSKTKUKVKWKXKYKZK[K\K]K^K_K`KaKbKcKdKeKfKgKhKiKjKkKlKmKnKoKpKqKrKsKtKuKvKwKxKyKzK{K|K}K~K!L"L#L$L%L&L'L(L)L*L+L,L-L.L/L0L1L2L3L4L5L6L7L8L9L:L;LL?L@LALBLCLDLELFLGLHLILJLKLLLMLNLOLPLQLRLSLTLULVLWLXLYLZL[L\L]L^L_L`LaLbLcLdLeLfLgLhLiLjLkLlLmLnLoLpLqLrLsLtLuLvLwLxLyLzL{L|L}LPt~L!M"M#M$M%M&M'M(M)M*M+M,M-M.M/M0M1M2M3M4M5M6M7M8M9M:M;MM?M@MAMBMCMDMEMFMGMHMIMJMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZM[M\M]M^M_M`MaMbMcMdMeMfMgMhMiMjMkMlMmMnMoMpMqMrMsMtMuMvMwMxMyMzM{M|M}M~M!N"N$N%N&N'N(N)N#N*N+N,N-N.N/N0N1N2N3N4N5NQt6N7N8N9N:N;NN?N@NANBNCNDNENFNGNHNINJNKNLNMNNNONPNQNRNSNTNUNVNWNXNYNZN[N\N]N^N_N`NaNbNcNdNeNfNgNhNiNjNkNlNmNnNoNpNqNrNsNtNuNvNwNxNyNzN{N|N}N~N!O"O#O$O%O&O'O(O)O*O+O,O-O.O/O0O1O2O3O4O5O6O7O8O9O:O;OO?O@OAOBOCODOEOFOGOHOIOJOKOLOMONOOOPOQOROSOTOUOVOWOXOYOZO[O\O]O^O_O`OaObOcOdOeOfOgOhOiOjOkOlOmOnOoOpOqOrOtOuOvOsOwOxOyOzO{O|O}O~O!P"P#P$P%P&P'P(P)P*P+P,P.P/P0P1P-P2P3P4P5P7P8P9P:P;P6PP?P@PAPBPCPDPEPFPGPTtHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZP[P\P]P^P_P`PaPbPcPdPePfPgPhPiPjPkPlPmPnPoPpPqPrPsPtPuPvPwPxPyPzP{P|P}P~P!Q"Q#Q$Q%Q&Q'Q(Q)Q*Q+Q,Q-Q.Q/Q0Q1Q2Q3Q4Q5Q6Q7Q8Q9Q:Q;QQ?Q@QAQBQCQDQEQFQGQHQIQJQKQLQMQNQOQPQQQRQSQTQUQVQWQXQYQZQ[Q\Q]Q^Q_Q`QaQbQcQdQeQfQgQhQiQYtjQkQlQmQnQoQpQqQrQsQtQuQvQwQxQyQzQ{Q|Q}Q~Q!R"R#R$R%R&R'R(R)R*R+R,R-R.R/R0R1R2R3R4R5R6R7R8R9R:R;RR?R@RARBRCRDRERFRGRHRIRJRKRLRMRNRORPRQRRRSRTRURVRWRXRYRZR[R\R]R^R_R`RaRbRcRdReRfRgRhRiRjRkRlRmRnRoRpRqRrRsRtRvRwRxRuRyRzR{R|R}R~R!S"S#S$S%S&S'S(S)S*S+S,S-S.S/S0S1S2S3S4S5S6S7S8S9S:S;SS?S@SASBSCSDSESFSGSHSISJSKSLSMSNSOSPSQSRSSSTSUSVSWSXSYSZS[S\S]S^S_S`SaSbScSdSeSfSgShSiSjSkSlSmSnSoSpSqSrSsStSuSvSwSxSySzS{S|S}S~S!T\t"T#T$T%T&T'T(T)T*T+T,T-T.T/T0T]t1T2T4T5T6T7T8T9T:T;TT3T?T@TATBTCTDTETFTGTHTITJTKTLTMTNTOTPTQTRTSTTTUTVTWTXTYTZT[T\T]T^T_T`TaTbTcTdTeTfTgThTiTjTlTkTmTnToTpTqTrTsTtTuTvTwTxTyTzT{T|T}T~T!U"U#U$U%U&U'U(U)U*U+U,U-U.U/U0U1U2U3U4U5U6U7U8U9U:U;UU?U@UAUBUCUDUEUFUGUHUIUJUKULUMUNUOUPUQURUSUTUUUVUWUXUYUZU[U\U]U^U_U`UaUbUcUdUeUfUgUhUiUjUkUlUmUnUoUpUqUrUsUtUuUvUwUxUyUzU{U|U}U~U!V"V#V$V%V&V'V(V)V*V+V,V-V.V/V0V1V2V3V4V5V6V7V8V9V:V;VV?V@VAVBVCVDVEVGVHVIVJVKVFVLVMVNVOVPVQVRVSVTVVVWVXVUVYVZV[V\V]V^V_V`VaVbVcVdVeVfVgVhViVjVkVlVmVnVoVpVqVrVsVtVuVvVwVxVyVzV{V|V}V~V!W"W#W$W%W&W'W(W)W*W+W,W-W.W/W0W1W2W3W4W5W6W7W8W9W:W;WW?W@WAWBWCWDWEWFWGWHWIWJWKWLWMWNWOWPWQWRWSWTWUWVWWWXWYWZW[W\W]W^W_W`WaWbWdWeWfWgWhWiWjWkWlWmWnWoWpWqWrWsWtWuWvWwWxWyW>XcWzW{W|W_t}W~W!X"X#X$X%X&X'X(X)X*X+X,X-X.X/X0X1X2X3XLX4X5X6X7X8X9X:X;XY?Y@YAYBYCYDYEYFYGYHYIYJYKYLYMYNYOYPYQYRYSYTYUYVYWYXYYYZY[Y\Y]Y^Y_Y`YaYbYcYdYeYfYtYatgYhYiYjYkYlYmYnYoYpYqYrYsYuYvYwYxYyYzY{Y|Y}Y~Y!Z"Z#Z$Z%Z&Z'Z(Z)Z*Z+Z,Z-Z.Z/Z0Z1Z2Z3Z4Z5Z6Zf87Z8Z9Z:Z;ZZ?Z@ZAZBZCZDZEZFZGZHZIZJZKZmZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZ[Z\Z]Z^Z_Z`ZaZbZcZdZeZfZgZhZiZjZkZlZnZoZpZqZrZsZtZuZvZwZxZyZzZ{Z|Z}Z~Z!["[#[$[%[&['[([)[*[+[,[-[.[/[0[1[2[3[4[5[6[7[8[9[:[;[<[=[>[?[@[A[B[C[D[E[F[G[H[I[J[K[L[M[N[O[P[Q[R[S[T[U[V[W[X[Y[Z[[[\[][^[_[`[a[b[c[d[e[f[g[h[i[j[dtk[l[m[n[p[q[r[s[o[t[u[v[w[x[y[z[{[|[}[~[!\"\#\$\%\&\'\(\)\*\+\,\-\.\/\0\1\2\3\4\5\6\7\8\9\:\;\<\=\>\?\@\A\B\C\D\E\F\G\H\I\J\K\L\M\N\O\P\Q\R\S\T\U\V\W\X\Y\Z\[\\\]\^\_\`\a\b\c\d\e\f\g\h\i\j\k\l\m\n\o\p\q\r\s\t\u\v\w\x\y\z\{\|\}\~\!]"]#]$]%]&]'](])]*]+],]-].]/]0]1]2]3]4]5]6]7]8]9]:];]<]=]>]?]@]A]B]C]D]E]F]G]H]I]J]K]L]M]N]O]P]Q]R]S]T]U]V]W]X]Y]Z][]\]]]^]_]`]a]b]c]d]e]f]g]h]i]j]k]l]m]n]o]p]q]r]s]t]u]v]w]x]y]z]{]|]}]~]!^"^#^$^%^&^'^(^)^*^+^,^-^.^/^0^1^2^3^4^5^6^7^8^9^?^:^;^<^=^>^@^A^B^C^D^E^F^G^H^I^N^J^K^L^M^O^P^Q^R^S^T^U^V^ftW^X^Y^Z^[^\^]^^^_^`^a^b^c^d^e^f^g^h^i^j^k^l^m^n^o^r^p^q^s^t^u^v^w^x^y^z^{^|^}^~^!_"_#_$_%_&_'_(_)_*_+_,_-_._/_0_2_1_3_4_5_6_7_8_9_:_gt;_<_=_>_?_@_A_B_C_D_E_F_G_H_I_htJ_K_L_M_N_O_P_Q_R_S_T_U_V_W_X_Y_Z_[_\_]_o_^___`_a_b_c_d_e_f_g_h_i_j_k_l_m_n_p_q_r_s_t_u_v_w_x_y_z_{_|_}_~_!`"`#`$`%`&`'`(`)`*`+`,`-`.`/`0`1`2`3`4`5`6`7`8`9`:`;`<`=`>`?`@`A`B`C`D`E`F`G`H`I`J`K`L`M`N`O`P`Q`R`S`T`U`V`W`X`Y`Z`[`\`]`d`^`_```a`b`c`e`f`g`h`i`j`k`l`m`n`o`p`q`r`s`t`u`v`w`x`y`z`{`|`}`~`!a"a#a$a%a&a'a(a)a*a+a,a-a.a/a0a1a2a3a4a5a6a7a8a9a:a;aa?a@aAaBaCaDaEaFaGaHaIaJaKaLaMaNaOaPaQaRaTaUaVaSaWaXaYaZa[a\a]a^a_a`aaabacadaeafagahaiajakalamanaoapaqarasatauavawaxayaza{a}a~a!b"b#b$b|a-b%b&b'b(b)b*blt+b,b/b0b1b2b.b3b4b5b6b7b8b9b:b;bb?b@bAbBbCbEbFbDbGbHbIbJbKbLbMbNbObPbQbRbSbTbUbVbWbXbYbZb[b\b]b^b_b`babbbcbdbebfbgbhbibjbkblbmbnbobpbqbrbsbtbubvbwbxbybzb{b|b}b~b!c"c#c$c%c&c'c(c)c*c+c,c-c.c/c0c1c2c3c4c5c6c7c8c9c:c;cc?c@cAcBcCcDcEcFcGcHcIcJcKcLcMcNcOcPcQcRcScTcUcVcWcXcYcZc[c\c]c^c_c`cacbcccdcecfcgchcicjckclcmcncocpcqcrcsctcucvcwcxcyczc{c|c}c~c!d"d#d$d%d&d'd(d)d*d+d,d-d.d/d0d1d2d3d4d5d6d7d8d9d:d;dd?d@dAdBdCdDdEdFdGdHdIdJdKdLdMdNdOdPdQdRdSdTdUdVdWdXdYdZd[d\d]d^d_d`dadbdcdddedfdgdhdidjdkdldmdndodpdqdrdsdtdudvdwdxdydzd{d|d}d~d!e"e#e$e%e&e'e(e)e*e+e,e-e.e/e0e1e2e3e4e5e;e6e7e8e9e:ee?e@eAeBeCeDeEeFeGeHeIeJeKeLeMeOePeNeQeReSeTeUeVeWeXeYeZe[e\e]e^e_e`eaebecedeeefehegeiejekelemeneoepeqereseteuevewexeyeze|e{e}e~e!f"f#f$f%f&fqt'f(f)f*f+f,f-f.f/f0f1f2f3f4f5f6f7f8f9f:f;ff?f@fAfBfCfDfEfFfGfHfIfJfKfLfMfNfOfPfQfRfSfTfUfVfWfXfYfZf[f\f]f^f_f`fafbfcfdfefffgfhfifjfkflfmfnfofpfqfrfsfufvfwfxfyfzf{f|f}f~f!g"g#g$g%g&g'g(g)g*g+g,gtt-g.g/gut0g1gvt2g3g4g5g6g7g8g9g:g;gg?g@gAgBgCgDgEgFgGgHgIgJgKgLgMgNgOgPgQgRgSgTgUgVgWgXgYgZg[g\g]g^g_g`gagbgcgdgegfgjggghgigkglgmgngogpgqgrgsgtgvgwgxgygugzg{g|g}g(h~g!h"h#h$h%h&h'h)h*h+h,h-h.h/h0h1h2h3h4h5h6h7h8h9h:h;hh?h@hAhBhChDhEhFhGhHhIhJhKhLhMhNhOhPhQhRhShThUhVhWhXhYhZh[h\h]h^h_h`hahbhchdhehfhghhhihjhkhlhmhnhohphqhrhshthuhvhwhxhztyhzh{h|h}h~h!i"i#i$i%i&i'i(i)i*i+i,i-i.i/i0i1i2i3i4i5i6i7i8i9i:i;ii?i@iAiBiCiDiEiFiGiHiIiJiLiMiKiNiOiPiQiRiSiTiUiViWiXiYiZi[i\i]i^i_i`iaibicidieifigihiiijiki{tliminioipiqirisitiuiviwixiyizi{i|i}i~i!j"j#j$j%j&j'j(j)j*j+j,j-j.j/j0j1j2j3j4j5j6j7j8j9j:j;jj?j@jAjBjCjDjEjFjGjHjIjJjKj|tLjMjNjOjPjQjRjSjTjUjVjWjXjYjZj[j\j]j^j_j`jajbjcjdjejfjgjhjijjjkjljmjnjojpjqjrjsjtjujvjwjxjyjzj{j|j}j~j!k"k#k$k%k&k'k(k)k*k+k,k-k.k/k0k1k2k3k4k5k6k7k8k9k:k;kk?k@kAkBkCkDkEkFkGkHkIkPkJkKkLkMkRkNkOkQkSkTkUkVkWkXkYkZk[k\k^k]k_k`kakbkckdkekfkgkhkikjkkkmknkoklkpkqkrksktkvkukwkxkykzk{k|k}k~k!l"l#l$l%l&l'l(l)l*l+l,l-l.l/l0l1l2l3l4l5l6l7l8l9l:l;ll?l@lAlBlClDlElFlGlHlIlJlKlLlNlOlMlPlQlRlSlTlUlVlWlXlYlZl[l\l]l^l_l`lalblcldlelflglhliljlklllmlnlolplqlrlsl~ttlulvlwlxlylzl{l|l}l~l!m"m#m$m%m&m'm(m)m*m+m,m-m.m/m0m1m2m3m4m5m6m7m8m9m:m;mm?m@mAmBmCmDmEmFmGmHmImJmKmLmMmNmOmPmQmRmSmTmUmVmWmXmYmZm[m\m]m^m_m`mambmcm4t7t8t=tDtGtHtNtOtStUtVtWtXtZt[t^t`tbtctetitjtktmtotptstwtxtyt}t*t)t000 000@>?00000N0000  <^%"\& %      00;=[]0 0 0 0 0 00000 `"f"g""4"B&@&2 3 ! &&%%%%%%%%%%%; 0!!!!0" """""*")"'"("!!"" ""#""a"R"j"k""=""5"+","+!0 o&m&j& ! %!"#$%&'()*+,-./0123456789:ABCDEFGHIJKLMNOPQRSTUVWXYZA0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 !"#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO%% %%%%%,%$%4%<%%%%%%%#%3%+%;%K% %/%(%7%?%%0%%%8%B%NUZ?Ta(cY"uPz`c%nefh'Weqb[Y{b}}b|[^ cfHhǕOgN OMOOIPV7YYZ \`apafipOupuy}}ÀcUz;SNNWxNXn82z(/AQpSTTVY_m-bp TS[poS\zNx&nVUk;YSfmtBVNKO SU0[q_ ffh8ll)m[tvNz4[`풲muvř`iSQW0XDY[^(`cclopqYqq?s~vт`[iXeZl%uQ.YeY__be*j'kksV,Ğ\l{QK\aƁvharYNOxSi`)nOz NSNUO=OOsORS VYZ[[yfggLklkpsyykSkWl"ooEotuv wz{!|}6f̊Qeӗ(8N+T\]sLvT/Z__`hjZtxw^NɛN|OOPPIQlQRRRSSTTUQWW}YT[][[]]]x^^^^_R`Labbc;efCffmg!hhi_l*mim/nn2uvlx?z|}}^}}T*RLaʐuq?xMؚ;[RRSTXboj_KQ;RJTV@zw`ҞDs opu_`rdkNVdWXZZh`aff9hhmu:}nBNPOSUo]]]glstxP߈PW^+cPPQgT^XY[i_Mbc=hskn}pǑrx&xmye0}܃ dR(WPgjQBW*:XiT]Wx\OJRT>d(fggzV{"}/\h9{SQ7R[bdd-gkіv֛LcvRf NPSq\`dce_hqs#u{~یxefkNN:OO:RSSUVXYYYP[M\^+^_`c/e\[eeegbk{klEsIyy|}+}󁖉^ifnj܌̖okNrtux:y 3ꁔPl_X+z[NSW1YZ[`nouꌟ[{rPga\J~Q\hcfenq>y}ʎndžPR:\Sg|p5rLȑ+[1_`;NS[Kb1gkrs.zkRQSjT[c9j}VShT[1\]Oab2myyB}M~Frt/1KlƖNOOEQAS_bgAl ncs&~͑SY[m]y.~|~XqQSO\%fwzQ_eoikmndov}]uQR@bffn^}rfRSsY^_U`dPQR SGSSTFU1UVhYY~ d_xRbcBdb-z{v} INHQCS`S[\\]&bGbdh4hlEmmg\oNq}qez{}J~z9nΌxwMRU8o6qhQyU~|LVQX\cffZiruuyVyy| }D}4;a PuRSS PUXOY=r[d\S``\cc?ccdef]iioqNuvz|}}aIXlňpmPXaӁ5 OtPGRsSo`Ic_g,nO^\ʌe}RSvQcX[k[ \ dQg\NY*YplQ>UXY`Sbg5Ui@ę(SOX[\/^_ `Ka4bfln΀Ԃ.۞ۛNS'Y,{Ln'pSSDU[Xbbblo"t8o8QSSFOTjY1]zh7rH=j9NXSVfWbceNkm[npwz{}=ƀˆ[VX>_efjk7uNJ$Pw0W_e`zf`luznE{\uzQ{Ąyz6Z@w-NN[_bm6t4xFZuO^bcWeogvLr̀)M PWZhsidqrXjyw)/OeRZSbgl}v{|6f or~Q{rx{H{ja^Qu`ukQbnzvOpbO{zVYX䆼4O$RJSSS^,deg>lNlHrrsTuA~,酩{Ƒiq=cifjuvxC*SQS&TY^|_`Ibybbekluvxy}w^ۘ j8|P>\_gk5t w;gz9Suf_񃘀<__buF{ee gllp2x+~ހ *JҒlONNPVRJWY=^__?bfgghQ!}~2 T,SP\SXd4ggrfwFzRlkXL^TY,gQvidxTWY'fgkTiU^ggR]hNOSb+glďOm~Nban+osT*gE]{\[JnфzY|l wR"Y!q_rw'a iZZQ T}TfvY]rnMQh}}bxd!jY_[ksv}2Q(gٞvbgR$\;b~|OU` }S_NQY:r6Α%_wSy_}3VgS aalRv8/UQO*QRS[}^`ac gggnm6s7s1uPyՈJĖYNYON?P|^Y[^ccdfJii mnq(uzIɄ! e} ~ab2kltmmeg<ma}=jqNuSP]koͅ-)RTe\Nghttuψ̑x_szNceuRAmn tYukx|zOnae\NNP!NQ[ehmsBvwz|oҊ|ϑuR}+PSgmq3t*W`tAXm/}^N6OOQR]`s|}o#,BTojpŒ2RAZ^_g|iijmobrr{~KΐmQy2֊-PTqjkČ`gNNkhi~nxU _NN*N1N6NYzUYPYNYZYXYbY`YgYlYiYxYYY^OOYYYYYYYY%ZZZZ ZZ@ZlZIZ5Z6ZbZjZZZZZZZZZZZZZZ [ [[2[Z*[6[>[C[E[@[Q[U[Z[[[e[i[p[s[u[x[ez[[[[[[[[[[[[[[[[[[[\\\ \\ \"\(\8\9\A\F\N\S\P\O\q[l\n\bNv\y\\\\Y\\\\\\\\\\\\\]\ ]]]\]]]]]"]]]]L]R]N]K]l]s]v]]]]]]]]]]]]]]]]]]]]] ^^^^^6^7^D^C^@^N^W^T^_^b^d^G^u^v^z^^^^^^^^^^^^^^^^^^^^^^^^_ _]_\_ ___)_-_8_A_H_L_N_/_Q_V_W_Y_a_m_s_w_____________________`_!`````)``1```+`&``:`Z`A`j`w`_`J`F`M`c`C`d`B`l`k`Y``````````````````_````Maaa``a``a!a`` aaGa>a(a'aJa?acMcdOcccccvcccccckciccccccccccd4ddd&d6ded(ddgdodvdNd*eddddddddddddddd ddbdd,eddddedeee$e#e+e4e5e7e6e8eKuHeVeUeMeXe^e]erexeeeeeeeeeeeeeeeeeerg ffesg5f6f4ffOfDfIfAf^f]fdfgfhf_fbfpffffffffffffffffff?ffffffggg&g'g8.g?g6gAg8g7gFg^g`gYgcgdggpgg|gjggggggggggggggggggggggjhFh)h@hMh2hNhh+hYhchwhhhhhhhhhjhthhhhih~hihih"i&ih ihhhh6iiihh%ihhh(i*ii#i!ihyiwi\ixikiTi~ini9iti=iYi0iai^i]iijiiiiiiiii[iiiii.jiiiiiiijji kiiijijiji jjj#jjDj jrj6jxjGjbjYjfjHj8j"jjjjjjjjjjjjjjjjjjjjjkjkk1k8k7kv9kGkCkIkPkYkTk[k_kakxkykkkkkkkkkkkkkkkkkkkkkkkkkkllll$l#l^lUlbljllllll~lhlsllllllllllllllllllmM6m+m=m8mm5m3mm mcmmdmZmymYmmmommn nmmmmmmmmmmmmmmmmm-nnn.nnrn_n>n#nkn+nvnMnnCn:nNn$nnn8nnnnnnnnnnnnnnnnnAooLpnnn?on1on2on>oonozoxooooo[oomoo|oXoooofoooooooooooooooo p popppopptoppp0p>p2pQpcppppppppppppp qpqqeqUqqfqbqLqVqlqqqqqqqqqqqqqqqqqqqqq rrr(r-r,r0r2r;rsNsOs؞Wsjshspsxsus{szsssssssssttot%ts2t:tUt?t_tYtAt\titptctjtvt~tttttttsttttttttttuuu uu uuuu&u,uz7zCzWzIzazbzizpzyz}zzzzzzzzzzzzzzzzzzzzzzzzzzz{{ {{3{{{{5{({6{P{z{{M{ {L{E{u{e{t{g{p{q{l{n{{{{{{{{{{]{{{{{{{{{{||{{`||||{{| |{#|'|*||7|+|=|L|C|T|O|@|P|X|_|d|V|e|l|u||||||||||||||||||||||;|||||}}}} }E}K}.}2}?}5}F}s}V}N}r}h}n}O}c}}}[}}}}}}}}}}}}=~}}}}}}}}}}}}}~ ~#~!~~1~~ ~ ~"~F~f~;~5~9~C~7~2~:~g~]~V~^~Y~Z~y~j~i~|~{~~}}~~~~~~~~~~~~~8:ELMNPQUTX_`higxqܘ !(?;JFRXZ_bhsrpvy}Qۀـ݀Āڀր )#/KF>SQqneft_Ɂ́сف؁ȁځ߁ )+83@YX]Z_dbhjk.qwx~߂҂ނ܂ ق5421@9PE/+#|su΃؃  " 8m*(ALONIV[Zk_lot}:A?HLNPUblxz|bȌڌ  N͌gmqsύڍ֍̍ۍˍߍ B504JGILPHYd`*cUvr|ƎŎȎˎێ  &3;9EB>LIFNW\bcdڏ!  '659OPQRI>VX^hovr}Hbې20JVXceisrɑˑБ֑ߑۑ,^WEIdH?KPZϒD."#:5;\`|nV֓דؓÓݓГȓ6+5!:ARD[`b^j)puw}Z|~ʕoÕ͕̕Օԕ֕ܕ!(./BLOKw\^]_frlΖ˖ɖ͖Mܖ Ֆ$*09=>DFHBI\`dfhRkqy|z×Ɨȗ˗ܗOz 8$!7=FOKkopqtsĘØƘ !$ ,.=>BIEPKQRLUߙۙݙؙљ+7EB@C>UM[W_bedikjϚњӚԚޚߚ"#%'()*./2DCOMNQXtʛƛϛћқԛ:   .%$!0G2F>Z`gvx *&#DA?>FH]^dQPYrozĝƝϝٝӝuy}a̞ΞϞОԞܞޞݞv!,>JRTc_`afgljwrv/XiYdtQq`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$`!a!b!c!d!e!f!g!h!i!I33"3M33'3363Q3W3 3&3#3+3J3;33333333{300!3!!22222122292~3}3|3R"a"+"."""" """5")"*"  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~abcdefghijklmnopqrstuvwxyz{|}~^"!!    RSTUVWXYZ[\^_&2A?JRf'138B@IKSg  " $0*.(469=;CGEPLTXVZ\`^dblpjrnhtxvy}{   !%+/)57:><DHFQMUYW[]a_ecmqksoiuwz~|NNN NNN#N$N(N+N.N/N0N5N@NANDNGNQNZN\NcNhNiNtNuNyNNNNNNNNNNNNNNNNNNNNNNNOOOO O OOOOOO.O1O`O3O5O7O9O;O>O@OBOHOIOKOLOROTOVOXO_OcOjOlOnOqOwOxOyOzO}O~OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPPP P PPPPPPPPPP"P'P.P0P2P3P5P@PAPBPEPFPJPLPNPQPRPSPWPYP_P`PbPcPfPgPjPmPpPqP;PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQQ Q Q QQPQQQQQQQ#Q'Q(Q,Q-Q/Q1Q3Q4Q5Q8Q9QBQJQOQSQUQWQXQ_QdQfQ~QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRRRRRRRR"R(R1R2R5RSBSLSKSYS[SaScSeSlSmSrSyS~SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTT!T'T(T*T/T1T4T5TCTDTGTMTOT^TbTdTfTgTiTkTmTnTtTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTUUUU U U UUU*U+U2U5U6U;UW?WEWFWLWMWRWbWeWgWhWkWmWnWoWpWqWsWtWuWwWyWzW{W|W~WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWXXX XW X XXXX X&X'X-X2X9X?XIXLXMXOXPXUX_XaXdXgXhXxX|XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYY Y YYYYAY!Y#Y$Y(Y/Y0Y3Y5Y6Y?YCYFYRYSYYY[Y]Y^Y_YaYcYkYmYoYrYuYvYyY{Y|YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZ Z ZZZZZ#Z$Z'Z(Z*Z-Z0ZDZEZGZHZLZPZUZ^ZcZeZgZmZwZzZ{Z~ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ[[[[4[[[[![%[-[8[A[K[L[R[V[^[h[n[o[|[}[~[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[ \\\\#\&\)\+\,\.\0\2\5\6\Y\Z\\\b\c\g\h\i\m\p\t\u\z\{\|\}\\\\\\\\\\\\\\\\\\\\\\\\\\]] ]]+]#]$]&]']1]4]9]=]?]B]C]F]H]U]Q]Y]J]_]`]a]b]d]j]m]p]y]z]~]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]^^ ^^^^^^ ^.^(^2^5^>^K^P^I^Q^V^X^[^\^^^h^j^k^l^m^n^p^^^^^^^^^^^^^^^^^^^^^^^^^^^________!_"_#_$_(_+_,_._0_4_6_;_=_?_@_D_E_G_M_P_T_X_[_`_c_d_g_o_r_t_u_x_z_}_~_________________________________________` ` ```````$`-`3`5`@`G`H`I`L`Q`T`V`W`]`a`g`q`~```````````````````````````````````````````aa a aaaaaaaaaaa"a*a+a0a1a5a6a7a9aAaEaFaIa^a`alaraxa{a|aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbb b"b#b'b)b+b9b=bBbCbDbFbLbPbQbRbTbVbZb\bdbmbobsbzb}bbbbbbbbbbbbbbbbbbbbbbbcc c c ccccc)c*c-c5c6c9cgEgGgHgLgTgUg]gfglgngtgvg{gggggggggggggggggggggggggggggggggggRhhhhh(h'h,h-h/h0h1h3h;h?hDhEhJhLhUhWhXh[hkhnhohphqhrhuhyhzh{h|hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhi i iiiiii1i3i5i8i;iBiEiIiNiWi[icidieifihiiilipiqirizi{iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiijjjjjjjj j$j(j0j2j4j7j;j>j?jEjFjIjJjNjPjQjRjUjVj[jdjgjjjqjsj~jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjkkkk kkkkkkk$k(k+k,k/k5k6k;k?kFkJkMkRkVkXk]k`kgkkknkpkuk}k~kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkklll l llllll&l'l(l,l.l3l5l6l:l;l?lJlKlMlOlRlTlYl[l\lklmloltlvlxlyl{lllllllllllllllllllllllllllllllllmm mmmmmm&m'm(mgl.m/m1m9mu?u@uCuGuHuNuPuRuWu^u_uauouquyuzu{u|u}u~uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuvvvvvv v vvvvvvvvvvv#v%v&v)v-v2v3v5v8v9v:vwBwEwFwJwMwNwOwRwVwWw\w^w_w`wbwdwgwjwlwpwrwswtwzw}wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxx x xxxx!x"x#x-x.x0x5x7xCxDxGxHxLxNxRx\x^x`xaxcxdxhxjxnxzx~xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyxxxxxy yyyyyy y%y'y)y-y1y4y5y;y=y?yDyEyFyJyKyOyQyTyXy[y\ygyiykyryyy{y|y~yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzz z z zzzzz!z'z+z-z/z0z4z5z8z9z:zDzEzGzHzLzUzVzYz\z]z_z`zezgzjzmzuzxz~zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{#{'{){*{+{-{.{/{0{1{4{={?{@{A{G{N{U{`{d{f{i{j{m{o{r{s{w{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||| | | ||||| |%|&|(|,|1|3|4|6|9|:|F|J|U|Q|R|S|Y|Z|[|\|]|^|a|c|g|i|m|n|p|r|y|||}||||||||||||||||||||||||||||||||}}} }}}}}}}}#}&}*}-}1}<}=}>}@}A}G}H}M}Q}S}W}Y}Z}\}]}e}g}j}p}x}z}{}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~}}}}}}}}}}}~~~~~~~ ~'~(~,~-~/~3~6~?~D~E~G~N~P~R~X~_~a~b~e~k~n~o~s~x~~~~~~~~~~~~~~<;=>?CDGORS[\]acdefmq}~  $&,.04579:<>@D`dfmquȀ̀πҀԀՀ׀؀  $',05:@CEMX]adeoqr{ȇɇʇ·Շևهڇ܇߇ (-.025:@BEFIORWZ[\abcknpsuz{|}ԉՉ։׉؉ "$&+,/57=>@CEGIMNSVWX\]aeguvwyz{~ÊƊȊɊʊъӊԊՊ׊݊ߊ  -07EGIKOQSTWX[]Ycdfhimsuv{~ŌƌɌˌό֌Ռٌ݌ eilnōƍǍȍʍ΍эԍՍ׍ٍ  !"#&'136789=@AKMNOT[\]^abilmopqyz{ÎĎǎώюԎ܎ !#%'(,-.4567:@ACGOQRSTUX]^eƏʏˏ͏ЏҏӏՏ ()/*,-347?CDL[]bfglpty̐ÐĐŐǐȐՐאِؐܐݐߐҐ  %"#')./14679:<=CGHOSWYZ[adgmtyz{‘Ñőӑԑבّڑޑ #$%&(./035689:<>@BCFGJMNOQXY\]`aeghinopuvwxy{|}’ÒŒƒǒȒ˒̒͒ΒВӒՒגْؒܒݒߒ !$%')*3467GHIPQRUWXZ^degijmopqstvz}ēœƓǓɓʓ˓͓̓ӓٓܓޓߓ ./1234;?=CEHJLUY\_achkmnoqrxy~ƕȕɕ˕Еѕҕӕٕڕݕޕߕ"$%&,13789:<=ARTVWXant{|~ʖҖ]ؖږݖޖߖ !"#(13ACJNOUWXZ[cgjnsvwx{}ėŗǗɗʗ̗͗ΗЗїԗחؗٗݗޗۗ   #&+./0235%>DGJQRSVWYZbcefjl˜ŘȘ̘"&'+123459:;<@AFGHMNTXY[\^_`Ùəәԙٙڙܙޙ  "#$'-.3568GADJKLNQTV]ÚƚȚΚКҚ՚֚ךۚܚ  &+-34579:=HKLUVW[^acefhjklmnsuwxyǛțΛЛכ؛ݛߛ "#&'()*1567=ACDEIJNOPSTVX[]^_cij\khnpruw{ /0234:?ABCDEFGHIJLNOPQRSUVWYZ[]^_`abcdefghijklmnorsuvy{|}~¬ìŬƬǬɬʬˬͬάϬЬѬҬӬԬ֬ج٬ڬ۬ܬݬެ߬ !"#$%&'(*+./0123679:;=>?@ABCFHJKLMNOQRSUVWYZ[\]^_`bdefghijknoqrwxyz~­íŭƭǭɭʭ˭̭ͭέϭҭԭխ֭׭ح٭ڭۭݭޭ߭  !"#$%&'()*+,-./23569;<=>?BDGHIKOQRSUWXYZ[^bcdfgjkmnoqrstuvwz~®îŮƮǮȮɮʮˮήҮӮԮծ֮׮ڮۮݮޮ߮  !"#$%&'()*+./1356789:;>@DEFGJKLMNOQRSTUVWXYZ[^_`abcfghijklmnopqrstuvwxz{|}~¯ïįůƯʯ̯ϯЯѯүӯկ֯ׯدٯگۯݯޯ߯  !"#$%&')*+,-./0123456789:;<=>?@ABCFGIKMOPQRVXZ[\^_`abcdefghijklmnopqrstuvwxyz{~°ðưʰ˰̰ͰΰϰҰӰհְװٰڰ۰ܰݰް߰  !"&')*+-./01236:;<=>?BCEFGIJKLMNORSVWYZ[]^_abcdefghijklmnopqrstuvwz{}~±ñıűƱDZȱɱʱ˱ͱαϱѱұӱձֱױرٱڱ۱ޱ !"#$%&'()*+,-./012356789:;=>?@ABCDEFGHIJKLMNOPQRSTUVWYZ[]^_abcdefgjklmnopqrsvwxyz{}~²òIJŲƲDzʲ˲ͲβϲѲӲԲղֲײڲܲ޲߲  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSWYZ]`abcfhjlmorsuvwyz{|}~³óƳdzɳʳͳϳѳҳӳֳسڳܳ޳߳ !"#$%&'*,-./012356789:;<=>?@ABCDEFGHIJKLMNORSUVWYZ[\]^_bdfghijkmnopqrstuvwxyz{|}~´ôŴƴǴɴʴ˴̴ʹδϴѴҴӴԴִ״شٴڴ۴޴ߴ  !"#&+,-./235679:;<=>?BFGHIJNOQRSUVWXYZ[^bcdefghijklmnopqrstuvwxyz{|}~µõŵƵǵȵɵʵ˵εҵӵԵյֵ׵ٵڵ۵ܵݵ޵ߵ  !"#$&'()*+-./012356789:;<=>?@ABCDEFGIJKLMNOPQRSTUVWXYZ[\]^_`abcefgijklmnopqrstuvwxyz{|}~¶öĶŶƶǶȶɶʶ˶̶Ͷζ϶жѶҶӶնֶ׶ضٶڶ۶ܶݶ޶߶  !"#$%&'*+-.1234567:<=>?@ABCEFGIJKMNOPQRSVWXYZ[\]^_abcefgijklmnortvwxyz{~·÷ķŷƷȷʷ˷̷ͷηϷзѷҷӷԷշַ׷طٷڷ۷ܷݷ޷߷  !"#&')*+-./01236:;<=>?ABCEFGHIJKLMNOPRTUVWXYZ[^_abcefghijknprstuvwyz{}~¸ĸƸǸȸɸʸ˸͸θϸѸҸӸոָ׸ظٸڸ۸ܸ޸ !"#$%&'()*+,-./0123456789:;>?ABCEFGHIJKMNPRSTUVWZ[]^_abcdefgjlnopqrsvwyz{}~¹ùĹŹƹǹʹ˹͹ӹԹչֹ׹ڹܹ߹  !"#$%&'()*+,-./01234567:;=>?ACDEFGJLOPQRVWYZ[]^_`abcfjklmnorsuvwyz{|}~ºúźƺǺɺʺ˺̺ͺκϺкѺҺӺԺպֺ׺ںۺܺݺ޺ߺ !"#$%&'(*,-./012379:?@ABCFHJKLNQRSUVWYZ[\]^_`bdefghijkmnopqrstuvwxyz{|}~»ûŻƻǻɻʻ˻̻ͻλϻѻһԻջֻ׻ػٻڻۻܻݻ޻߻  !"#&(*+,./235679:;<=>?BFGHJKNOQRSTUVWXYZ[\^_`abcdefghijklmnopqrstuvwxyz{|}~¼üżƼǼȼɼʼ˼̼μҼӼԼּ׼ټڼۼݼ޼߼  !"#%&'()*+-./0123456789:;<=>?ABCDEFGJKMNOQRSTUVWZ[\]^_`abcefgijklmnopqrstuvwxyz{|}~½ýĽŽƽǽȽɽʽ˽̽ͽνϽнѽҽӽֽ׽ٽڽ۽ݽ޽߽  !"#$%&'()*+,-./0123456789:;<=>?@ABCFGIJKMOPQRSVX\]^_bcefgiklmnorvwxyz~¾þľžƾǾȾɾʾ˾̾;ξϾҾӾվ־پھ۾ܾݾ޾߾  !"#$%&'()*+,-./0123456789:;<=>?BCEFGIJKLMNORSTVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~¿ÿĿƿǿȿɿʿ˿οϿѿҿӿտֿ׿ؿٿڿۿݿ޿  !"#$%&'()*+,-./0123456789:;=>?@ABCDEFGHIJKLMNOPRSTUVWYZ[]^_abcdefgjklmnopqrstuvwxyz{|}~ !"%()*+.23457:;=>?ABCDEFGJNOPQRSVWYZ[]^_`abcfjklmnoqrsuvwyz{|}~ !"#$%&'*,.0356789:;<=>?@ABCDEFGIJKLMNORSUVWYZ[\]^_abcdfghijknoqrsuvwxyz{~€‚ƒ„…†‡Š‹ŒŽ‘’“”•–—™šœžŸ ¡¢£¦§©ª«®¯°±²³¶¸º»¼½¾¿  !"#&'*+,-./0123456789:;<=>?@ABCDFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgjkmnoqstuvwz{~ÀÁÂÃÅÆÇÉÊËÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿ  !"#%&'()*+-./12356789:;>?@ABCDEFGIJKLMNOPQRSTUVWXYZ[\]^_`abcfgijkmnopqrsvwxz{|}~āĂ㥹ĆćĈĉĊċČčĎďĐđĒēĕĖėĘęĚěĝĞğĠġĢģĤĥĦħĨĩīĬĭĮįİıIJijĴĵĶķĹĺĻĽľĿ  !"#$%&'*+-./1234567:<>?@ABCFGKOPQRVZ[\_bcefgijklmnorvwxyz{~ŁłŃŅņňʼnŊŋŎŐŒœŔřŚśŝŞşšŢţŤťŦŧŨŪūŬŭŮůŰűŲųŶźſ  !"#&')*+/1268:<=>?BCEFGIJKLMNORVWXYZ[^_abcdefghijkmnprstuvwz{}~ƁƂƃƄƅƆƇƊƌƎƏƐƑƒƓƖƗƙƚƛƝƞƟƠơƢƣƦƪƫƬƭƮƯƲƳƵƶƷƻƼƽƾƿ "#%&')*+,-./24689:;>?ABCEFGHIKNPYZ[]^_abcdefgijlmnopqrsvwyz{ǀǁǂdžNjnjǍǏǒǓǕǙǛǜǝǞǟǢǧǨǩǪǫǮǯDZDzdzǵǶǷǹǺǻǾ !"#%&'()*+.02345679:;=>?ABCDEFGJKNOPQRSUVWXYZ[\]^_`abcdefghijklmnorsuvwy{|}~ȂȄȈȉȊȎȏȐȑȒȓȕȖȗȘșȚțȜȞȠȢȣȤȦȧȩȪȫȬȭȮȯȰȱȲȳȴȵȶȷȸȹȺȻȾȿ 000% & 0 %"<<"    000 0 0 0 0 00000`"d"e""4"2 3 !+!B&@& ""#""a"R"; &&%%%%%%%%%%%!!!!!0j"k""=""5"+","" """""*")"'"(" !"#$%&'()*+-./012356789:;<=>?@ABCDEFGHIJKLMNORSUVWYZ[\]^_bdefghijkmno!!""^.""" !0 %%%%d&`&a&e&g&c&"%%%%%%%%%%%h&&&&& ! !!!!!m&i&j&l&22!3"!33!!qrsuvwxyz{}~ɀɁɂɃɄɅɆɇɊɋɍɎɏɒɓɔɕɖɗɚɜɞɟɠɡɢɣɤɥɦɧɨɩɪɫɬɭɮɰɱɲɳɴɵɶɷɸɹɺɻɼɽɾɿ  !"#$%&'()*+,-./0123456789:;=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]  !"#$%&'(*+,-./0123456789:;<=>?@ABCDEF112131415161718191:1;1<1=1>1?1@1A1B1C1D1E1F1G1H1I1J1K1L1M1N1O1P1Q1R1S1T1U1V1W1X1Y1Z1[1\1]1^1_1`1a1b1c1d1e1f1g1h1i1j1k1l1m1n1o1p1q1r1s1t1u1v1w1x1y1z1{1|1}1~11111111111111111GHIJKNOQRSUVWXYZ[^bcdefgijklmnopqrstuvwxyz{|~ʀʁʂʃʅʆʈʉʊʋʌʍʎʏʐʑʒʓʔʕʖʗʙʚʛʜʝʞʟʠʡʢʣʤʥʦʧp!q!r!s!t!u!v!w!x!y!`!a!b!c!d!e!f!g!h!i!ʩʪʫʬʭʮʯʰʱʲʳʴʵʶʷʸʹʺʻʾʿ %% %%%%%,%$%4%<%%%%%%%#%3%+%;%K% %/%(%7%?%%0%%%8%B%%%%%%%% %%%!%"%&%'%)%*%-%.%1%2%5%6%9%:%=%>%@%A%C%D%E%F%G%H%I%J% "#$%&'()*+,-./0123456789:;<=>?@BCDEFGJKMNOQRSTUVWZ[\^_`abcefghijkl˕333!3333333333333333333333333333333333333333333333333333&!3333333333333333333333mnopqrstuvwz{|}~ˀˁ˂˃˄˅ˆˇˈˊˋˌˍˎˏːˑ˒˓˔˕˖˗˘˙˚˛˝˞˟ˠˡˢˣ˥˦˧˨˩˪˫ˬ˭ˮ˯˰˱˲˳˴˵˶˷˹˺˻˼˽˾˿&2?ARfJ`2a2b2c2d2e2f2g2h2i2j2k2l2m2n2o2p2q2r2s2t2u2v2w2x2y2z2{2$$$$$$$$$$$$$$$$$$$$$$$$$$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$S!T![!\!]!^!  #$'138@BSgKI222222222 2 2 2 2 222222222222222$$$$$$$$$$$$$$$$$$$$$$$$$$t$u$v$w$x$y$z${$|$}$~$$$$$t  %&*+-/1234567:?@ABCFGIJKMNOPQRSVZ[\]^_abcegijklmnoqrstvwxyz{|}~̀́̂̃̄̅̆̇̈̉̊̋̌̍̎̏̐̑̒̓A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~0000000000000000000000̶̷̡̢̧̡̛̖̗̝̞̟̣̤̥̦̪̮̯̰̱̲̳̹̻̽̾̿̕̚00000000000000000000000000000000000000000000000000000000000000000000000000000000000000  !"#%&')*+-./012345678:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[]^_ !"#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNOabcefghijknprstuvwyz{|}~͇͉͍͎̀͂̓̈́͆͊͋͌ͅ͏͓͖͙͚͐͑͒͗͛ͣͦͨͪͫͬͭͮͯ͟͢͝͞͡ͱͲͳʹ͵Ͷͷ͸͹ͺͻͼͽ;Ϳ "#%&')*+,-./246789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWZ[]^bcdefgjlnopqrsvwyz{}~΀΁΂΃ΆΈΊ΋Ό΍ΎΏΒΓΕΖΗΙΛΜΝΞΟ΢ΦΧΨΩΪΫήίΰαβγδεζηθικμνξο  $,-/0189<@KMTX\pqtwxzĬȬ̬լ׬ !"#%&'()*+.2345679:;<=>?@ABCDEFGHIJKLMNOPQRSVWYZ[]^_`abcfhjkl  ),-458?@ABCFHJKLMNOQRSUVWYZ[\]^_abcdefghijknoqrsuvwxyz{~ЀЂЃЄЅІЇЈЉЊЋЌЍЎЏАБВГД߱  4?BFGHIJKNOQRSUVWXYZ[^`bcdefgijkm@ACDEKLMPT\]_`aĵ̵͵ϵеѵص%,4HdhԶ(),/089;DHLTU`dhpqsu|}nopqrstuvwxyz{}~рстухцчщъьэюяѐёђѓєѕіїјљњћќѝўџѢѣѥѦѧѪѫѬѭѮѯѲѴѶѷѸѹѻѽѾѿјǷɷ $%(,45789@DQS\]`dlmoqx|øŸ̸иԸݸ߸ <=@DLOQXY\`hi  !"#$%&'()kmtux|ȹɹ̹ιϹйѹҹعٹ۹ݹ޹89<@BHIKMNSTUX\deghipqtxĺȺغٺ*+./12356789:;>@BCDEFGIJKLMNOPQRSTUVWXYZ[]^_`abcefghijklmnopqrstuvwxyz{|}~҂҃҅҆҇҉ҊҋҌ  )+4568;<=>DEGIMOPTXaclĻȻлӻ $%')-0148@ACDEILMP]ҎҏҒғҔҖҗҘҙҚқҝҞҟҡҢңҥҦҧҨҩҪҫҭүҰҲҳҴҵҶҷҺһҽҾҙļͼϼмѼռؼܼ $,@HILPXYdhԽսؽܽ DEHLNTUWYZ[`ad "#$&'*+-./1234567:>?@ABCFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghihjpqstu{|}оѾԾ׾ؾ @ADHPQUſ̿ͿпԿܿ߿?ABCEFGHIJKLMNOPQRSTUVWXYZ[]^_abcefghijklnpqrstuvwz{}~ԁԃԄԅԆԇԊԌԎԏԐԑԒԓԕԖԗԘԙԚԛԜԝ4<=HdehltuyĀĔĜĸļ (),089;=DEHIJLMNSTUWXY]^`adhpqstu|}ŀńŇŌōŏőŕŗŘŜŠũŴŵŸŹŻżŽžԟԠԡԢԣԤԥԦԧԨԪԫԬԭԮԯ԰ԱԲԳԴԵԶԷԸԺԻԼԽԾԿ $%(,-.034579;@ADHPQSTU\]`loqxy|ƀƈƉƋƍƔƕƘƜƤƥƧƩưƱƴƸƹƺ  !"#$%&'()*+,-./0123456789:;>?ABCEFGHIJKNPRSTUVWZ[]^_abc  !$(01357<=@DJLMOQRSTUVWX\`hktux|}~ǃDŽDžLJLjljNJǎǐǑǔǖǗǘǚǠǡǣǤǥǦǬǭǰǴǼǽǿ dfgjlnopqrsvwyz{}~ՀՁՂՃՆՊՋՍՎՏՑՒՓՔՕՖ՗՘ՙ՚՛՜՝՞՟ՠաբգդզէթժիլխծկհձղճմյնշոչպջռսվտ $,-/18<@HILMTpqtxzȀȁȃȅȆȇȋȌȍȔȝȟȡȨȼȽ ,4PQTX`aclpt|ɈɉɌɐɘəɛɝ !"#%&'()*+,./01234567:; )LMPT\]_`ah}ʄʘʼʽ !AHILPXY]dxy˜˸ !"'(),.089;=>?ABCDFGJLNOPRSVWYZ[]^_`abcdefhjklmnorsuvwxyz{|}~րւքֆևֈ։֊֋֎֏֑֖֛֢֣֤֥֦֧֪֚֒֓֕֗֘֙֜֞֠֩<=>DEHLTUWXY`dfhpų̴̵̸̘̙̜̠̩̫̬̭̼ $(,9\`dlmoqx͈͔͕ͤͥͧͩ͘͜Ͱ  !$(0135ֱֲֳִֵֶַָֺּֽ֭֮֯־ֿ XY\_`ahikmtux|΄΅·ΉΐΑΔΘΠΡΣΤΥάέ $,-/018TUX\degipqtxπυόϡϨϰ-458<!"#$%&'*,./0123679:;=>?@ABCEFHJKLMNORSUZ[\]^_bdfghjkmnoqrsuvwxyz{~׀ׂ׃ׅׄ׆ׇ׊׋DEGIPTX`lmpt|}ЁФХШЬдезй 0148:@ACDELMPT\]_ahl|фшѠѡѤѨѰѱѳѵѺѼ ,-04<=?AH\׎׏בגדהוזחךלמןנסעףdҀҁ҄҈ҐґҕҜҠҤҬұҸҹҼҿ  !%(),089;<=DE|}ӀӄӌӍӏӐӑӘәӜӠӨөӫӭӴӸӼ@D\`dmoxy|ԀԂԈԉԋԍԔԩ <=@DLMOQXY\`ehikmtux|ՄՅՇՈՉՐե $-89<@EHIKMQTUX\gipqtփօ֌֍֐ְֹֻ֔֝֟֡֨֬ ()+-458aha9eiouvv{˄U[QW|(PSE\]bncdd np[yݍ}E~NNeP]^aWiqTGu+^NPpg@h QRRjwԞR/`HPacdkLp/tt{PŃܕ(.R]`bOIQ!SX^f8mprsP{[fSckVNPJXX*`'abiA[}_NPTU []]*eNe!hKjrvw^}N߆NʐUNEN]NNOwQR@SSSTVuWW[]^abQeggiPkkkBlnxprstwwvz}  ߂b3dҙEם W@\ʃTzو͎XH\cz[_yzz&P8RRwSWbrc km7wSWshvՕ:gjpom̎Kwfxk<S-WNYcisExzz|us5RGWGu`{̃XjKQKRRbhuiPRRae9hi~tK{냲9яI NYdfj4tyy~_ & OS%`qbrl}f}NbQwOOvQQUhV;WWWYGYY[\]]~^_beegg^ghh_j:k#l}llms&t*tttxuuxxAyGyHyzy{}}-OHw!$Qe}vO TbThёU:Q Za bbfVq OczcWS!g`isn"7u#$% }&'rVZ()*+,CN-gQHYg.sYt^dy_l`b{c[[R/tY)_`012Yt345678љ9:;<=>?@ABCoDE`FGfHI?\JKLMNOPQZ%{g}RSTUVWXY<\l?SnY69NNFOUWXV_eejkMnwz|}ˆ2[dozsuTVUMWadfm[nmoouCANJZlSuT{]UXXXb^bdhvu|NWnW'Y \\6^_4bds۞[_`PR0RW5XWX\`\\]^_`ccdChhjm!nnoqvywy;zHSMvܗkpXrrhscwy{~X`feeflqqZmNzNQQR TaqgPhhm|ouwzc\Qe\gguzsZF-o\Ao _]Yjq{vI{'0Ua[iv?\mpsa}=]j^NuSkk>pr-LRP]d,ekoC|~ͅdb؁^gjmrtotސO ]_ QceuNPiQQhj|||oҊϑO7QRBT^na>bejo*y܅#bjΞRfwkp+ybBab#e#oIqt}o&#JQRR mpˆ^eko>|usN6OV_\]`s-{F4HaOoyR`ddj^oprv\2ouxy}Ƀ֊X_'g'pt`|~!Q(pbrxŒڌNP[^eqBvwJ|'XAZb\jmo;v/}7~8KRegiAmnp t`tYu$vkx,^mQ.bxO+P]m}*_DahaRQQ^iz}uO)RSTUe\`Nghlmrrttbul|yψ̑БɛT~oqtWgm3t,xz {|idjtuxxT[U^ oNMS)Z]N_ba=ciffn+ocpw,;E;Ub+gl jzNY__g}T+WYZ['fghkdqu㌁EL@_[lsvv QMQQRhlw w}}bnQ T}Tff'invw„iOQRY=^Uaxdydfg!jkk_rarAt8ww((glgrvfwFzkl"Y&goSXY^c4fsg:n+szׂ(R]aa bbdeYifkk!qs]uF~j'aX؞PR;TOUevl } }^RlirsTZ>\K]L__*ghcieee fginx!}+*2 POcW_bcogCnqv̀ڀ)Mj/OpO^g"h}v~vDa^ jiqqjudA~CܘOO{pQ^h>lNllr{l:tPRXdjtVvx9e^S_%RwINPuQ[\w^f:fghpuuyz' O!X1X[nfekmzn}os+u܈\OPS\S[_ gyy/9;,gvNOIY\\\gchpq+t+~"Ғ NNOPVRoR&TTW+YfZZ[u[[^fvbweenmn6r&{?|6PQ@tܑDٙSR)TtVXTYnY_anbf~lqv||}g[O__b)] gh|xC~lNPS*SQSYbZ^`aIbybegikkkklh5tuxxyy|}>船l^ۘ;V*[l_ejk\mop]rsӌ;a7lXMNNNN:Oy@y`yy{}r} фdž߈P^܌fߙJRigjP*Rq\ceUls#uu{x0wNdk^q NkIghnkco NPPQFUUV@[\\8^^^^`QhajXn=r@rrvey{saތ^XtUlaz"}rrru%um{XX]^^_U`bcMefffhhr^tn{n}}r͞ YmY-^`fsfgPlm_owxƄˑ+NPHQU [[Gb~ee2n}qtDtttlvy}U~z9ux%MhSQ\Til)m+n ;-gaRfk~ ]emqnWY['``bf_f)ssvwl{VreNRrkmz9{0}oS/VQX[\\]@bcd-fhlmnppq&uuuv{{+| }9},m4 a7Ol\_gm|~k[] d\ᘇs[`~gm 7RpQpxpבOSUVWXZ[\\%^a bKbcd6exe9jk4lm1oqrxstt&vawyWzz|}}a~)1ڄꅖ8Bl֖ӚS~XYp[[mZoq!tt]__B`ehoiSjk5mmsvwM{}#@cbĊ bSe]']i]_thob6rNXNPRGSbfi~^OS6VYZ8\N\M\^_C`e/fBfggsw:ÿ́fiUzW[_o`b ik\nq{UXߘ8OOO{T Z[T3TUbXXgYZ[`aVeedfhZlopqRs}{2K\lDss:netviz~ @QXdtupv͖T&ntzzنxIZ[[hicmst,tx}UL.f_egjls-PZjkwYl]]%sOuPQ/X-YYY[]bdddfHjqdtzzG~^~p YR~a2ktm~%OPQRWX[^Baimgnnqbt(u,us8Ʉ ޓNQOvP*QSSS[[$\aae[rs@tvPyyy}Յ^GꑅRg_e1f/h\q6z NRjkoqSK1NqĖCQSTWWWZZ[(`?acl9mrnn0r?sWtтE`bXg^MOIPPqS WYZ \paf-n2rKt}Àf?_[U˗OsNOQjQ/UUz[[|^}^^``a ac8e gggaibil'm8no6s7s\t1uRv}8Ոۊ0BJ>zIɑn XkAQkY9\dosbph}Wi`GakYNTm-pclQaOPQ[aadikuwdcpNN O7YY]_[_!`>rspuuy 3Q 7pvNNRpSTVY[__nnj}5mwNZO~OXen8NXYYA`zOÌeQDSNiRU[N:RTYYP[W[\[c`Hanpnqstux+}(Ʌnj̖\ORVe(f|pp5r}Lrq[hkzov\f[o{*|6ܖNN S4XXXlY\3^^5_cfVgjj k?oFrPstz|x߁灊l#υ݈wQT(W[MbPg=hh=nn}p!~ KN-r{͊GONO2QTY^bugnijlnr*su{5}W[Ζ_R TZ[XduenrvMz{M|>~{+ʌd_iѓCOzOPhQxQMRjRaX|X`Y\U\^`0bhkloNq t0u8uQurvL{{{{~n>I?"+ZkR*bbYmdvz{v}`S\^8op|ޞczdvNNN\PuPHTY[@^^^_`:c?eteevfxfghijck@lmmn^nppss:u[wxy z}z|}Gꊞ-Jؑf̒ V\6RR|U$X^_`chomy,{́Dd=LJOFQQR2V_k_cdeAfffghhionogqq*rt:wVyZyy zz||D}p~T m;Ֆe|ÓX[ \RSbs'P[_`kahm.t.zB}}1~k*5~POPW]^+cj;NOOOZPYĀjThTUOY[]^]f1gg*hl2mJnopsuL|},}}ۆ;p31NRDЙz|OQQW[\Yf=jZmno qouz"!u˖-NNF͑}SjkiAlzXafbpuuR~IKNST0W@W_ccod/eezfggbk`ll,ow%xIyWy}󁝂rvz7zT~wUUuX/c"dIfKfmhik%mnshtt[uuvwwy ~~/:ь뎰2csOSYZ^Nhtuyz̍폟egWWo}/Ɩ_aoNOPSUo]]!kdkx{IʎnIc>d@wz/jdoqttz|~|~ }L9R[d-g.}PSyXXaYaaez P!PuR1UUXY`Sbb6gUi5@ݙ,PSSDU|WXbdkfgoo"t8t8QTVfWH_aNkXpp}jY+cw=TX-di[^oniLQS*Y `Kakpll{΀ԂƍdodeNQTW_avhuR{q}Xi*9xPWYYb*]ayr֕aWFZ]bddwgl>m,r6t4xwۍ$RBWgHrt*kQSLciOU`WelmLrrzm_opaOOPAbGr{}MjWs^g U T[c^^ _e=[HOS SSTTW^`bbUclfmu2xހ/ނa E^ffprO}Rj_SaSgjothyhyǘĘCTzSiJ|_buvB9S<__lsbuuF{ON< NUOSY^0flUtwfPXx[P[h``eWl"oopUPӗrRDQ+TTcUUjm}fwyTTv䆤ԕ\N OYZ]R`bmgAhl/n8* NUPTWZYi[[awiwm#pr犂홸R8hPx^OgGLNTVs WSVX[1aj{sҎGkWUYrkiO\&_a[flpsss)wMwC}b}#~7R IoQ[tz@ZOTS>Y\>cymrϒ0NDQRWb_lnpPppqsitJanQW_`gafYJNNN|TXX}Y\'_6bHb fgfkimmVnnooo]pr%tZttv\y|~ဦkN_twje`bwZZfm>n?tB_`{T_^ll*mp}y ;ST[:jkpuuyyqAt d+exxkz8NUPY[{^`cakefShneqt}i%;mn>sAʕQL^_M``0aLaCfDfil_nnboLqtv{'|RWQÞ/SV^_b``affgjmoppjsj~4ԆČRrs[kjTV][Heefhmm;ruMOPST?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABIDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abidefghijklmnopqrstuvwxyz{|}~ɤ́΁ҁӺԹہܺݹ‚߱·󸽽  !"#$%&'()        7 C7 7 7 utf8_general_ciutf8_bindec8dec8_swedish_cicp850cp850_general_cilatin1_german1_cihp8hp8_english_cikoi8rkoi8r_general_cilatin2_general_ciswe7swe7_swedish_ciasciiascii_general_cicp1251cp1251_bulgarian_cilatin1_danish_cihebrewhebrew_general_cilatin7latin7_estonian_cslatin2_hungarian_cikoi8ukoi8u_general_cicp1251_ukrainian_cigreekgreek_general_cicp1250_general_cilatin2_croatian_cicp1257cp1257_lithuanian_cilatin5latin5_turkish_ciarmscii8armscii8_general_cicp866cp866_general_cikeybcs2keybcs2_general_cimaccemacce_general_cimacromanmacroman_general_cicp852cp852_general_cilatin7_general_cilatin7_general_csmacce_bincp1250_croatian_cilatin1_general_cilatin1_general_cscp1251_bincp1251_general_cicp1251_general_csmacroman_bincp1256cp1256_general_cicp1257_bincp1257_general_ciarmscii8_binascii_bincp1250_bincp1256_bincp866_bindec8_bingreek_binhebrew_binhp8_binkeybcs2_binkoi8r_binkoi8u_binlatin2_binlatin5_binlatin7_bincp850_bincp852_binswe7_bingeostd8geostd8_general_cigeostd8_binlatin1_spanish_ciucs2_general_ciucs2_bin d'@Bgb2312gb2312_chinese_cigb2312_binh!l!'!c!@!A!$("(((&(:(,(*(0(.(B!4(2(9(!(%('()(-(1(#(+(/(3(5(6(7(8(&!%!!&"&#&$&%&&&'&(&)&*&+&,&-&.&/&0&1&2&3&4&5&6&7&8&A&B&C&D&E&F&G&H&I&J&K&L&M&N&O&P&Q&R&S&T&U&V&W&X&''!'"'#'$'%'&'(')'*'+','-'.'/'0'1'2'3'4'5'6'7'8'9':';'<'='>'?'@'A'Q'R'S'T'U'V'X'Y'Z'['\']'^'_'`'a'b'c'd'e'f'g'h'i'j'k'l'm'n'o'p'q'W'*!,!.!/!0!1!-!k!d!e!y!f!m!q"r"s"t"u"v"w"x"y"z"{"|"{!|!z!}!J!G!F!L!X!^!O!N!D!E!I!H!R!S!`!_!C!K!W!V!U!Y!T!\!]!Z![!Q!M!P!Y"Z"["\"]"^"_"`"a"b"E"F"G"H"I"J"K"L"M"N"O"P"Q"R"S"T"U"V"W"X"1"2"3"4"5"6"7"8"9":";"<"=">"?"@"A"B"C"D"$)%)&)')()))*)+),)-).)/)0)1)2)3)4)5)6)7)8)9):);)<)=)>)?)@)A)B)C)D)E)F)G)H)I)J)K)L)M)N)O)P)Q)R)S)T)U)V)W)X)Y)Z)[)\)])^)_)`)a)b)c)d)e)f)g)h)i)j)k)l)m)n)o)v!u!x!w!t!s!p!r!q!o!n!b!a!!!"!#!(!)!4!5!6!7!8!9!:!;!>!?!~!2!3!$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z$[$\$]$^$_$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$!%"%#%$%%%&%'%(%)%*%+%,%-%.%/%0%1%2%3%4%5%6%7%8%9%:%;%<%=%>%?%@%A%B%C%D%E%F%G%H%I%J%K%L%M%N%O%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s%t%u%v%$!E(F(G(H(I(J(K(L(M(N(O(P(Q(R(S(T(U(V(W(X(Y(Z([(\(](^(_(`(a(b(c(d(e(f(g(h(i(e"f"g"h"i"j"k"l"m"n";R!6_FrMIU}HOIBO"X;2kS$Xs3(WRG'X@JpG{15RT4+6?K)X*6=AOQ%I-Xv8>Q\cPVa7.4YA/XKDC>1X4CeR.VZN'Uu:&7V@9FREGGT9K3RR?XE>rF2R0OgOiJ@XrBRBiH,GKAhSyUBJ~6!XZSw?FT%;AXeN.>(XGQ)P=XoYvM:?;=%:`Rz2`:6DmO)>$MAAWGqYtYKHiXZR2JJHlXjXFXv=MFp3kXq=i=THS4XBV2PWKJ{KLU68IOZYpX*GnXz4nATRmXGRoXGCvQYVrXuX~<[<NH]7B7sFxXARiN?<|7%7]PZVESo;a;qX!I0N+4sXKIvXWBwX1NyX.2@9#Yi0fAlIEKFK$Yh5+5;NM5!WtWSSeLN:"Y\Y`S}Xp7wW~XzX!YcD6StX]Y{XeEP@pQ[0Q<&Y%Y,Y.Y+Y9J)Y6V^3(Y}@LJ*Y'Y0Y16)9@R@OBBD=lU`2HGk?-Y/YjNn:VGc1Y4m64Y!?^YNG~@8YWK}75Y7Y#1aS9YEP6Y1Y2Y)A3Ys<^P)8c>=Y:Y30BYDY61?Y95s>HLr:PRCYh=+3EYk>FY;Y_D>YAY@Y.U5VcGHYYkH+HK0+9yAbY<@29X9KPx1dF_>d5HWxQf<^J=)EZ9#Z)T$Z{Y,6k7y1|Ye3v>v?1Rd@36~Y}Y;>`FF-?K;J5I[WP9M<0v3w;J[/:dT65s5VXPHV7PGWX/?;[XXLP.;>kPAuArTU844u3>IPEYE{@p1YXN9=5ZXFV"K/H2IL4L?t9[X\Xg6A#Jt<18n8bXK=dXcX|EeXfX&A0Hl0&9S[?[x@">M@@[FJ*2BScC+QB[U@C[1?6PaZdG'3r6|Lz@w@9QaQGX^2e@q:HX-TaOIXJXCOx3G>KXL[%HXO~HN2VSf20mA6_5_;VP=YUH0#6I?(L3_7JRSOX6RE:>K>L7_p54_uST3w8:_O:*_ALMwRM7A_D_q7I0V6T7,:}LT?1KtF(VE_bN33|N54GNp:aN=Q@_t4J3f8;_ED<_=_>_;E?_B_1TC_:GXNXDJ_O_\VI_Z_6NG:N_H_^EkIt:|CW>F_M_XE&UM:L>=S@8dVG_>9'?|AK_L_P_[_e_W_V_IWc_d_ke'RR_)?[TH?T_LO]_JQ^_'07FS_e:_6[M~9UT__lO%0g_Q_FQU_X_Y_\_);`_a_b_f_h_4Sg86Ej_ZI(ADD^?xO\Un_82_:l_A[dQtK=4&0q_FLr_m_i_k_o_p_=;s_t_#;[J(N'`*3&`!`~_YM|_z_P?DWLIx_!0}_{_"`(`H7!F6I2@u_>EDXy_vD#`$`%`%P4`dL1`&?/`9N+`FI.@.`m:0:)`v_3`8`-49`2OH:0`zP,`{Tw_gE-`wS6`7`D`aP<`I`J`>`*`$IA`2`HJC`5`KNCKM`F`B`K`:`?`@`E`G`H`L`;`TKU`V`R`P`N<Q`B8EXjPoBO`=`T`S`W`\`X`vV03lW;KZ`{NY:a`]`-Rb`[`Y`_```^`d`wF,XkTf`IJe`A8g`h`i`c`?:gLj`yOk`BH@=RDl`m`tGDKn`X;6XrRo`EMZ6q`0T'@Q4'Np`r`L9z9;7P[.L2?5;xWS?i?a<3L^[S0kNX79WBF$@9Lg[a[:Fc[h[wEj[i[@?f[e[94,@"Bb[d[MPm[]@r[b6s[R[89+Tl[Q?p[Q[f5k[e?n[q[y[!9#0qBG3o[x[RFt[u[w[v[~[rS:2}[$\{[z[|[`Ey;#\%\CLQ6@]!\"\5Gi6'\&\)\$1L50?_QB6(\zKsk\K~KAL{H*\nL+\S[/\,\3>{J-\JI9D=G.\vTfP+DU6T[Z1U[V[>:@H?JIH3WyIG?x:8hBQH{eJ6K<}Q!fnC$f~e%fWMA7|e}e#f]D(f'fCC^F*f7D"foI7fp6dCiS4f5f"H=f9fEFqM;ff:f7@$S?ftICfDfvP=CDCBfAfGf1OtkJfEf^<)I5<SOHfIfNfPfQfKfU5LfOf[DFfMfRfTfSfUfxYVfWfSW]f^fW?PTVWf4oKZfCXNW"POC_f>eg4T6BK0Q<5YJb7dI+=>NpW!PYI{6Xfb<>3PIYf"3L^HSM^"RN^M>O^,J|R_3jeaD!>2NrDV>(Fc2S>|GkLl=]N:JAFlea@aAaGag3iF^4BQHaFaEaCaBa@18UDaKaLaJazoSaRa6GIaNaPaTaQaMaOaUaVaWaXaZa[a!N]g(4]V2Q23$9sWIG^>.9WNn2O[:}4_a\:`a2;IBaalP=MbaC5GEcadaySea-Qfa"NgaB5haU;DP`bX1dRabIV|M&CCcRVgbhbGSlbl?mbeb@3nDnbCPv:ib^73;,LKKdbfbjbkbwbtbuTsb-EzUBE@2obrb/AoMs;hL/c1c'O.c)N];k5e>R2M391+cQ2,5_9h6kO7cL;GHJP8cn3)mzSdS*m9cbR5c^SP83c6c_74c"@:c8TH4;cE;wIeI=D+m}B[;.??Nc-m?c):,m=c@c6:.68PC0.m/mA@Ac3EBc2\0mj8lN'jgPyJVH7OI3RNd=^cr;(j=U]F)j*j,j+j.j-jX=/j>BA4w4';flel?7yKb1glHIhlilVJP^E2zTKFG0r4SHPM8?[?$G4V)@Q^(IoQ$Eg063EHb0v7zEs6RUP3<<-3q>Q0VRcJ%W6M669?[U'8WER^Y?UB@G$;(1jE{E'L'1V5(DS^:Qi3rCw7tV#5p24DiD-@T^h0DE`AU9\>XMN0OMV^P>>WU^PU]0bD#Bp<5S9@!E&2qT(@CJW^|U09-H)KY^=?4F'W0JCDV3R98V|j40f?tLZM?VNBNN"L.PSD25X^uU762L@pKq<;;75uEf^c^]>_^74]=`^mDFO`5^6ZJt5e^FUa^ML~FEE4Rr>SB=L83S=X?FMZQk4d^]^g^~j0Bb^@V'5t2h^r^m^q^`HaWo^hCaLe2>Rn^k^UN'4+?>>R=i^.T^^j^?@l^s2i8'BA=u^x^+2$4j4&Iv^QKc8w^z^y^BLa0n4:e/Pk2!kt^cIs^Z0!Rw1/Lp^$K*U{^]4&D}^~C!D!_LA|^o>2FE3vH:K~^$_2W73CAKG%2i4+WlD"_#_%_3:&_^@CIY2fG'_\G(_"kSK*_)_A2JE+_\TAH,_p>-_'V7j6kUJ|XD8%9E7~UJ9'PMtP5tCH>7k=0L=2AV1(3R8"IX68k4>}JCG{Us7DN+Us13l_05l76OAzu1PeUSNo=b3+86U=mO69KBP=76l)JTE9l8lCB7l}P:l;leWj%@;j}2wCh;WRtN?jzNgG'>PjGV@A]TQj>ORjnJ/E50TjSj_t:D)1_eUjoJVjWjXFXjYj;TzG7R|8Bj\2|BxTfLnWBTPSCksE~7Tk7K^kJ@{M/3ZF|k>D4N)D>1}TuJlVSFd6z;`P1IST(HK8>hHaHOhThVhq9XhuW{D\hi2Qhm<B?MhyVxAq2_hAJYh$Uj1;UNhPh06Sh]h8@wJ(K\Fu@ih#PrhjV`hahyQK:y8q8TTohnhlhp9RLfh&Nr?80qhph@Wdh)M#I8;[=jhbhcheh55ghEGkhmh0=.Wxhuh0Mvh:Ahh7Cp0thwh#9RINC`Nf@sK]L5PaJshl<yh^CeFw9t0XW,<oEDL&i-I"ib@C?~hW9{h$iNR#i2V5W'i7=|h}h!iVM,R2i)i*4;4+i(P%i~3,ic@*i9i8i.izh(i,?1i:i%B/iE8-i\S4i5i7iGiF@Ei0i;iq0i?iAiqA6H=iBiCi3i6i1;@iw<DiFiJiNi[2Hi.7KiLiAU#DXia:Ii#STiWiPiOiAGRiYiH3SipOMiw3ViZi4L-OUi\i[i^iQi]i_iJC7GN46;@P#l7E{S$l%l[Fn?&l'l*P8Gh8(l9V}UK4=2dNgFaMu4@K_<bicijQeiy4di3QbJP2hifigi3Viijikili/l9EN6sRn5Y;1lcRcN8D?C>69XH1O1Q1~EP1+C1U$kA::L%k'k(k&k)k+k*k,kOJ5XqC%CxF-kJD.k/k0kU7z71kbG3k$:uQ102k4k*5HBhG5k.K_c@S[Y!M-VsG`Yc;::bc+O`cGI9:4QacjH/9-=X3[N@LhcictM-L3<jckcZP{FZ7_GJRVNdclcrIA3gccFec3mfc3IfE59;Ccc=E$AYBW2mc&;-DpcZ>{cucS:P7MSNVSUA94UXQ9PvG*H42ZCnc|coc(7wctc:7"Evc]E(2|F`D"Wa@yczc}c)Lsc>SC14mqcrcxc:PCFsT~c`='d&dsQ#d)dwH4O(d.deB46r="di:*d,d}6^V2d-d!dn;]M"GIEwA$d3G,===%dGWb2+dC4l;MQmL5meG(TKdUWBd%=EdfSIdxI>deS~GI6|T32WdBNMdFWVTS2>lAj/B64WQ432H;?@lKV?lAlElf>?LZE<>Fl~1Dl(Uc5Bl6Ac3Cl8KC@~LRAHlf:S@rVLQ>?37UIGlb;LL}=HH)OiMkEi7IQ8:IlJl@;Klbl:1Y79=LlfQMl;HQlSlM;e<Ol7I:CclUUPlsVRlNlTlUl?I(O\P,Q[HVluNlJZlYl>0WlXldl88/RV0y53X,K]c,Ff0FE9k:k;k@Q#Erj2D5DN@sjADoNpjtj|I#GXL~Nujvj,Og@wj?6xjyjzj{jqj.Hka87lama4WnaoaLSqaq?paR571sara|:ta79Q>|D]:F=uawa@6AO(JvaxU|Sxa|ayazaj@~a!bG@{a}a%bTA#b(b~2"bMCB2'b&b$b)b+bIPmV(C,bWO.bo:`i-b*b+;3T0b/bai1b2b3b!L4b5b~PJBqSuM`gagA>jBdgcgfM5Cbg7;VOaAighgtg#2jgfglgkg:IdUeg)7ggngsgiVmgrgqg`0ugrGE@m@pApgvgvK"h!hAWzgyg{gwg~g}g|gUAYG}ECEmG#h&h%h'hw:xg$hpH*I)he9~Q(h*h-h.h'A/h0h,h4h+h1h5h2h3h7h6hO9,p-p0Fj0?H_MMN1j2j?FI43jgUy]4j5j6jJ80_uIpLzI{ICS&K&8.pB18eoLISW^p1E]pqQ`pL0j=_R_p/4h7fpep#FapbpC4cpnU[LR>2<hpgpdp!2"V8S7>,HjpwQLV[:ip;64M&F!Akpnpmppplp>;op5LrpU3T1sptpvpa4qpwpzpxpup}pyp|p~p!qAN$q#qvA{p]Jq4q11L&q'q,qNU)q3H"q+q(q%q*q)0-q/q1q0q.q"Q2q3qo9G5W0Y0mTD5T=J;'p^8(p(0)pnM*p+p$FeVdqeqsC[SQVhE/SfRAn;05UNQ`xmwL[QEWvU|m{mymzm}m&>/K!n=6"n@D~m^=G2C6%n:X#n&niCr3'n$n9O(nwB)n*n+^3FFGuVI52K+n+M,n0U-nDvG[#4,Cfq8JSR*VroX>C=soL6+0/J6m7myN/7s?8mkB0I9mvF3?miEFFiIRTAmBmCmEmy@!4h9PmQmJmOmxN6KLmMmuORmrA2SKm7Ho<pEVmo55B-0iK.1TmkMb5UmSmWmz5XmYm\mL1vEnJjlq@gIklnFllmFmlplfWslqlnlol#WqInKtlrliOvl1F@<ul;5v;wlwY{=;Bxlyl#8zl{l|lmS.Xk@]GL:cP=K:MQ8|1oGVVF?kCuoXCbWwoS3XGmQHVxovo};F3U=FR`;!O|o{oyoL3TI0K~o^0IV}om3UvHN"p!p>5Z<|;e8BD#pkK&p(Q?>nG6q7qU?)48q;MTG-U9q:qOG$ROV;qQ=04=>\4QN_?=qz?q@qAq~A"AzJ>U:>9>BU"?/M5q_=K6qVCsDsM8FsGsJ0EsIsqKKs&PJ1HsOsQ5WsRsTsSs{7?1NsJsZ5PsQsUsMsc<}AVsZsLsH5n=\s$7p?~V2Mp4_2XsYs8I]s^sas_scsbs[sj?o3`s)Gr<ks?9ds-2~;cKmsis\9nsesfsjsaBlsoshs}<dOpsgsrs-W*Fssqs(B]8usts[4vswsxs:@i@qE{szsX4~sys|s}s!t#tI;"t$t>2&t%t.<WCaY`@LtQW[7Nt#AIFV43UPtOtQtZKRtAT`V`78A;ASt,>b4TtUt+>Vt[tWtZt}:XtYtb8GL\tZ2SCcT7?]t4Eit5OINXKwKt=OW[@uPjtktltcw17mtkWntyf@>zfl:{fKO|f*gs0^Ha=+gFH,gf;x8$Q-ggBx>J=3M.g/gn>ePgKPLL<0g(g?g)<@gAg6gP6BgCgDg:;^5FB`1Eg5TFg?8HgGgl7Igx2JgKgLgMgNgOgPg'SuKQgRgSgTgIIUgVgWgXgYgI=Zg>sW81H?s@sAs^9xMhX1:^B7n#79n8nU0;nVUoWCV=npJn@n?nrQyqO4zq2m1m`K^RAKXUbH_@!<Ak$PbVG6X8@kN8?k&3I9+Vt7J7g<>7FkGk90O?Ek}SHkIkN7BkDkvIWVMU2POk8NPk(531Rk%LVESkQk_ENk$JUk{0z:7XcqJkKkLkMkVk@fYkh?HRWk\kl8Xk:=XP70]k\D,V`4vB9<Zk[k`TjFTD_k'EuY12dkE=bkck,8QMekak3A"FsLfk0@8Rgk/8-8hk;GsMjkkkmkHPrknkqkyH|Qlkik98YOeDokpkZLHMr0vkuk22`8wkl1EL$D%Oyk"lrEzkEI_b~kNM!l[17S\R}k{k<30jTW+tt3AVBViUJ>'t(R(t)t*tK>_S`IaIBsfJrL6b4KhN[V-t.t/t2t=:3tc00t1t"=U26t7tf602OO4t,45t8t9t'M:t;tt?t^t\R7E0G\>PA\(;<7L\F\?\[G?Q@\J\P\-NB\C\H\I\T2Q\UK7T[\_\&Lf\gC\\A?Y\z069e\S\D\V\tH`?;I=1"SZ\U\;F^\BW/C67QG)Cb\X\k\T\]\%>W\`\c\d\x\a\"]g\kt\]2s\vz>J:J]E]?]K2C]K]$2U]>]PFP]T]bAF7N]O]D]=]M]QLI]B]HCGz]|]~]"^*0N1,^&^6=oH!^%^)^(^'^-^LT3^*^.^Y@!16^1^2^&Q5^/^0^=P4^mJ9^8^7^;^e=X2jC:^:E<^YL*7eT=^?^"DA^>^@^:UB^.r";2B0EGB/riP]S=kf30r1r-Jg:3r5r4rdK:O2r4JORlBCN8rv07r>rO2AQ:rijjjkjljmjnjojG={u}u~u|ub=!v%4"v#v2lTQjY$v:n2U~S\LDJ@e%v/>)F%ZF<)6<8OH%<&Z'ZVLCH(Z}F5QiR6QG<2=d;)Z*ZHQ+ZmPo6[BOKm7hIC7w>$V,Z-Z@FgW6J)U_KoU.Z_VJ40Z/ZkR1Z2Z3ZTJ4Z+J5Z6ZO3oV7Z0;.58Z9Zn9/QhR:ZC8jOo2;ZZUSe;?Z5KPK@ZkGnVAZ5EA6BZL7N?CZDZ-KEZw5FZBA;WGZ8LjR1DHZ}5Q;IZ3PJZKZ=NLZMZNZw2QZOZhQPZUCRZSZTZUZ;P%Ry0VZ+GWZw=!CXZYZ}C7LZZ[Z>@WF\Z]Z4G^Z_ZH9m;96xtytcM9u`ksO?;@:%TYatu*1r2uuwuQ:vu2Cyuxu41jU:819F2pTMO\0KUu;JV770L6Fa1:9|Va9!7zTDuLuO0x5IuJu\EEuFuGuKu`>Huz8PuSug?r9Xu_L[uH2YWYuZu\ubu`u_u]uau^udueucL?e85cuhu#Lfugu>uD1?uE5d2luiuW6mujukuZ4jTnuy3ouqupurusumI*9{Gc6IL&j53~Tl9yPmi*WniVBmHd:oipiqiaVrisiuitiviwiaGxiXTyiN=zi{iO=|i(8>A}i21T;u9~i!j"j#jx7-<dJN`/T=O7U$j^U%jAP<9G4Y11@f1g1h1=3hHAe_1IAo4(GXSyF8Q}9uB-SKT|=Be57Ce9;bUx=6T%N,AY3vLFeDeHeJeGeO5HF|5EevJIeTCE1#<7WKMMKJJSLLeKefD!Q7QMePe8MpVOe]5>MQe:6(Md9EJQ3YKlTRej7NeUe~4VeSeTe]R_BF1bS]6lKWevSi1t6ZeXeYe@5ER\e^e]e2G#R[ebTZU`eqWae\1{QbedeceeeXRK5_guZxZvZwZzZOPGDn00PyZJS*:"[qG|Z{Z[I}Z![^W~ZZA%[tS'[$[([<=I@#[&[#V)[-[.[,[B:$?+[*[GT?2/[y90[;3&5<61[u62[I14[3[5[7[6[8[9[:[OSztuGCWdE|t}t{tF>oPS7MT*L"u!u(:~tVK$uR@j3*M%u#u4=(u)uM=8Ca?aK*u&u'upD,u<4mWW4+u.u-u/uQPQC)H0u1u2u3u4u5u7u6u8uI2TSMJo@XV0R?Ap=*8x<FvGvHvIvJvLvKviwMvNvDnEnFnkU$6HnGnInJn%GKnLn07v5MnOnNnF8PnQnRn[6.3SVFD51V8SnTn?TUG{>YN39VnUnXnWn%EYnZn.G[n/G\n'2]n^n_n`nanjWbncnXo?o}N@o`B846Wu=GOCoAoBoDo'6|LCEoFoGoOoHoIoJoBGqoM6KoLoMoF6>CNoPoQoRorUSowDToxDUoVod8w0WoXoYoZo[o\o]o^o5>ao_o`obocoMAdoeofogohoiojokoloX@mo-AnooopobO$3ECEcAIFcU1JN34rHGcPOHcd2>e5G7??RCfCLXo8y=%QP00w1w,P002w3w4wJGO>7w6w^15w8w9w$NMH+:8h9h:hB>tROTXI3R%6jG|qnO3KkPoggMK9Y6}qd0LK~q$T-BlADF1>!rU<"r#r$rCR5FGM%r1SE?bL&r'rUQn6(r)r_5*r+r|2,r-r'Hg7)l*l+l,l.F-l.lI73J8bOwPwM2QwSwRw;b"<b?b@bAb97{R$=NJ%1GKBb|6DHCbH=}1Dbv6EbYDFbZO]9Gb!@Hbv2IbsAJbKbxBLbMbNbWJ8XeYcO%p0\mB&TTM1Q[3}G52?B`f;JafbfT>cf$WUMef]=hffB':ifjfR3iQ%?kfoFlfmfnf-Fof'Ipfqfrf9esftfbBufvfhVwfxfG9;w:w>wuvvvwvxvzHyvzv{v|v}v~v!w"w#w$w%w&w'w(wn1)w*w+w,w-w[A.w/wqD/p&<0pyC8E;Q1p2p3p4p5pp?pi>@pl6ApBpCpDp5HEpFpGptEHpIpJp=wKpLpMpNpOpW:PpQpRpSpTpUpVpXp%SWpYp:u9Bdwewfwgwhw4BjwkwsBptotiBawbwF;dYrJh@$pZ:-G,Dlwmwnwpwowqwtwswrwuwvwimjmkmv&6>XD9;X1\sJwwxwyw{wzwG1|w}w~wkF4l]33v4vdA5v6v7v8v9v:v#H;vzA(9hmj9_Y!#"###g!%#&#'#(#)#*#+#,#-#.#/#0#1#2#3#4#5#6#7#8#9#:#;#<#=#>#?#@#A#B#C#D#E#F#G#H#I#J#K#L#M#N#O#P#Q#R#S#T#U#V#W#X#Y#Z#[#\#]#^#_#`#a#b#c#d#e#f#g#h#i#j#k#l#m#n#o#p#q#r#s#t#u#v#w#x#y#z#{#|#}#+!i!j!~#$#000000 ^ &     000 0 0 0 0 00000006"'"("""*")""7"""%" "#"+"."a"L"H"=""`"n"o"d"e""5"4"B&@&2 3 !0 !&&%%%%%%%%%; !!!!0$$$$$$$$$$$$$$$$$$$$t$u$v$w$x$y$z${$|$}$~$$$$$$$$$$`$a$b$c$d$e$f$g$h$i$ 2!2"2#2$2%2&2'2(2)2`!a!b!c!d!e!f!g!h!i!j!k!  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 !"#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO+Mk1111 1 1 1 1 1111111111111111111 1!1"1#1$1%1&1'1(1)1%%%%%%%%% % % % % %%%%%%%%%%%%%%%%%%% %!%"%#%$%%%&%'%(%)%*%+%,%-%.%/%0%1%2%3%4%5%6%7%8%9%:%;%<%=%>%?%@%A%B%C%D%E%F%G%H%I%J%K%JU?W(cT UTvLve^aUޘ*S T^l9Z)TlR~_Wq~l|KYN_$a|0N\g\ Θup"QIYQ[O&T+Yweu[vbbE^l&{OO gnmmy_+ubOܑe/Q^PtoRK YPN6ry[DYTvVV9eivnr^uFggzvaybecQR8~\/n`g{vؚ|dP?zJTTLkdb=urRi[sn;uRS݋i_`mOW"ksSh؏bc`$Uubqm[{^RLaĞxW'|vQ`LqCfL^M`pp%c_b`ԆVk`gaIS`ff?yOpGl~dfZZBQmmA;mOkpb` 'xyQ>WW:gxu=zy{eo!Y~  TghM|ƖS%`urlsSZ~$cQ ]߄bQc[OmyBR`Nm[[e_EY~~ Vg9YsO[RZ>2uGPNlZbnc]wQݍ/OS`pgRPcCZ&P7wwS~d+ebcP5rɉQ~GW̃QT\OzZmᐏUTaST_cwiQha R*XRNW x w^wa|[bbNpbp`wWۂghxyXTS4nKQ;R[CUWs`QW-TzzP`T[cbScb[gTzw^8YWcWWw{O_[>k!SP{rFhw6weQNv\zuNYAP'andWfFcVbib^WbU!JfUegV݄jZhb{pQo0cȉapntir^ΐgjm^cRbrlOYjpmRPNm~x/}!QWd{|lh^iQShrΞ{ryotNg̑xS)RPOOuz|lRtTOTޏp^`m^[e8K`p~|Qh|o$Nϑ~fNdJPuq[foNdc^eRˆpRs3tgx4NޜmQATbsÔ6OQupu\SNn tikxYuR$vAmgmQKT<{zWbG|iZd{oKbS^pcdSOx2B^oyU_F.btTݔOee\a\Q/l_sn~\cj[nuSqNceubn&ONl~W;#{=m~YsxlVTWpNVSȏ wnfba+o)+vl_+skwƔoSQ=^8HNsghv dql wZAk'f[YZN jv0sh_[/wa|%_s|yʼnl[B^h w~QMQR)ZbׂcwЅy:n^YmplbvOe`f# T}T,xdyd!jxidTb+gX؞l o[L _rgbarNYkXfU^RUa(gvfwgrFzbTPTZ~lCNvYHYWS7uV c|`mbTQZY*Pl<\b`O?S{n+bt^xd{c_Z?\OcB}[nUJMm`grQ[bl[rmb~SmQ_tYR`sYfPu*ca|T'k%kՅUTvPljU,r^`6tbcLr_Cn>meXovxvTu$RSSN^e*րbT(RpэlxTڀWTjMiOlUv0xbpom_h|x{ gOgcxoWx9ybbR5tkdU>uv9SuPA\l{OPGrؘothydwb+TXRNjW s^QtċO\aWlFZ4xD돕|VRQbNa郲W4gWnffm1fpg:khbYNQoglvQhGYgkfu]PeHyAyw\^NO/TQY xhVlď_}llcp`=murfbŔCS~{N&~NԞMR\ocEm4XL] kIkg[TTX7:_bGj9re`ehwTNO]d\OzRN/`zONy4tRdy[lR{"l>PSndtf0l`w^y7x3u{T8Om Z~^yl[vZuNanXu%urrGS~wviR܀#W^1Yren׋8\qASwbeNߘ[ƋSwON\vY_:yXNgNbR/fUlVNOʑpl^C`[ƉՋ6eKb[[c.US&v}Q,ghkbSmufNNp[qffr͞ ^\/gh_g bzX^pe1oU`7R Tdp)u^hbS=r4lawz.TwzUxgped6V`ySN{k[UV:OUcTن\~*gsTOuÀUOMO-n \pakSv)ne~;T3z }UtcmzbegScl]\TLNalK\eh>T4TkfkNBcHS OO^W bdfirRR`fqgRxwpf;V8T!zrzo` ^`Y`qpnPlrj-^`NZUm|b~w~#Sf\Or NSYTc(HQN~T$T7m&_Z>fis.sSz[wP~vSv{DXnaNey`TNy]ajPTa']xJRTVm[mSf\][!hxU{HeTiNGkNOSc:deQhxSall"Q\ #ke__OEfe)s`tQRWb_Lx^Og'`YDQQSylĖqOO=gUy~X bZV{_ĄWSe^\ud`n}Z~~iU[`es cv)w~tf[tz@Rq_e[o]k[l ŏSb&-@T+NYr]YmŖTN qT pmv%Nx\^plDYcopYvtGd'\ez#YTo0iNV67rΑQ_NucNSfKYmNX;ScO Oc7YWyNul[Y]_iP]YNwNzbfy\Ny_Ɓ8uNԈak_INvn㋮ ы_~5kVk4YTm[n9\_pS1jtZp^($%gGΏbvq_lx fTbcOÁu^͖ Tlm8l`R(u}^O`_$\1url8nI gSSQOɑS|^mNvi^aYOO>| annN1ZN\y[틽sWTGU\_a2krtm[Ոkm3 nQCQWScVXTW?sn܏т?a(`bf~Í\|g`NShAQЏt]UfU[S8xBg=hT~p[}Q(WTef^Clm|QgeojV vvpq#bRl<`Xaf`NbU#n-gg(whiTMNpȋXde[z:P[wky|lve-]U\8h`Sbz[n~jzp_3o _cmVgN^&N4vb-f~blugqiFQSnbTُYmsewu'xOguʋ/cG5#cAw_rN`tebck?e'^uѐg/e1TwAlKN~Lv ikgbS\fScSRRR-R3R?R@RLR^RaR\R}RRRRRQTNNNNNNNNON"OdON%O'O O+O^OgO8eZO]O_OWO2O=OvOtOOOOO~O{OO|OOOOOOOOOOOOO)PLPO,PP.P-POP P%P(P~PCPUPHPNPlP{PPPPPPQPPPPQ QN=lXOeOOFlt|nQ]ɞQYR SSQYUQNVQNnN҈y4[QQQQQQQQ‹Ëˋϋ΋ҋӋԋ֋؋ً܋ߋ  !%'*+./2356iSzS"!1*=]4]=]l][]o]]]k]K]J]i]t]]]]s]]s_w____________ba_rrrrrrrrrrrrrrrrsrsrrss!s ssss"s9s%s,s8s1sPsMsWs`slsos~s%Y$YYcghijkltw}^^^^^^^^^^S^^^^^____`_`___``___`5`&``` `)`+` `?`!`x`y`{`z`B`j`}````````````````` a&aa#a`aa+aJauaaaaaaa_ ,N?rb5lTl\lJllllllhliltlvllllllllllllllllllll9m'm mCmHmmmmm+mMm.m5mmOmRmTm3mmommm^mmm\m`m|mcmnmmmnmmnmmmnm nm+nnnNnknn_nnSnTn2n%nDnnnnn-onnnnnnnnnnnnboFoGo$oon/o6oKoto*o o)ooooxoro|ozoooooooooooop#pp9p5pOp^p[[[[[[/u4d[[0[GӏՏ & !56-/DQRPhXb[ft}P_W_V_X_;\TP\Y\q[c\f\*_)_-_t<_;n\YYYYYYYYYYYYYYYYZZYZYYY Z Z2Z4ZZ#ZZ@ZgZJZUZusssssssssssssss| tssssst*t[t&t%t(t0t.t,tttAt\tWtUtYtwtmt~ttttttttttttttLgSg^gHgigggjgsgggugggggwg|gg hg hgg hggggghggghgg2h3h`hahNhbhDhdhhhUhfhAhgh@h>hJhIh)hhhthwhhkhhnihi ih$ih iiWihiqi9i`iBi]iikiiixi4iiiiiificiyiiiiiiiiiiiiiii/jijjejiDj>jjPj[j5jjyj=j(jXj|jjjjjj7sRskkkkkkkkkkkkmqrsuvxwyz|~Ύ bbbb"b!b%b$b,btttuuu4eeee ffrgfffpff4f1f6f5f_fTfAfOfVfafWfwffffffffff236;=@EFHIGMUYljʉˉ̉ΉωЉщnrr]rfror~rrrrrrrc2cc?ddkkkkklll lllll!l)l$l*l2l5eUekeMrRrVr0rbR gۀ€Āـ̀׀g݀ gZ6,2HLStYZq`i|}mgMXZń&gʁ$k7k9kCkFkYkјҘӘ՘٘ژk@_keQeeeeeeeeepppppppppppqqq/q1qsq\qhqEqrqJqxqzqqqqqqqqqqr(rlpqfqq>b=bCbHbIb;y@yFyIy[y\ySyZybyWy`yoygyzyyyyyy__<`]`Z`g`A`Y`c``a a]aaaaabllmwwx xxxxe-xxx9x:x;xx?B5DEFILNORSTVWXY[^_]abdefghijkloqrs:wwɖyyyyzG]zzzz9z7zQzϞpzvvvvvtt,u "()*+,216879:>ABDFGHIKLNQUWZ[\^cfghijklqmsuuuuuuuuuuuuuuuuuuuuuuuvuuuvvv vv v%vvvvvv3vMv^vTv\vVvkvovzxzyzzzzzzzzzzzdir}ƈɈΈ! 4+6Af{u倲vvw "%&')(1 5CFMRiqxMTlnz|{ĆΆɆφІކ߆؆ц #;%.>H41)7?"}~{`pLnSc|dYe҇Ƈ凬ˇӇчʇۇ !9<6BDEzz{{{{ {+{{G{8{*{{.{1{ {%{${3{>{{X{Z{E{u{L{]{`{n{{{b{r{q{{{{{{{{{{{{{{{{{{{{{{ |{{|| ||*|&|8|A|@|D!"#-/(+8;34>DIKOZ_h~؈߈^||Ie||||||||||||||||nf|w}}}G~~sgmGIJPNOdbapio}~rtyU~Yič֍׍ڍލ΍ύۍƍ ,.#/:@95=1IABQRJpv|otxe։މډ܉>&S*-0> ΖҖwȒ>jʓ>k#zĜŜƜǜʜ˜̜͜ΜϜМӜԜ՜ל؜ٜܜݜߜ|XŚš˚̚њECGIHMQ .UTߚ#;~֓۞ܞݞߞ",/97=>Dgbkgbk_chinese_cigbk_bin!7B,+ 9I4c&(LSFNIIXA8J Jd? 99.-!A" >,.\FG/&7,o2:p -QN@) '&J )9fLz:Y; Gz1G HC%HQLL %}f@oP5?<B`K 8 759 j2 AHs? "Rr/iLAAIDq|/B ~.u "N= 2FDOC.-DERo4Q/I:IP)Rrp4'P ?HOB48@C`1,p4 %E 8>#XI%JP+E(R)Z F_R&6%: ;D. P U ( 9=d8>-C>L|BE>"hAI]T&d26q/A+B\EY? Q#O:ND-} GLD# GQsHx %?#}T=9**iA-HA7]3K x2\6UR 6@L=G<AF 8!_7 HHO *GLE\O oQ+IDF PL>!Ni7@:Q ;BM6.^N)x<nA72  6%UDKwH\<;HHYQN$KNqT/:7 LOT7U zRO32GnD'(&y0B&(*L2C_T%1n$ 3a1 P@9z@ =i iC'  '1CC,I I3R6IT!a.>J "  ?7N< j#-2+{A5.4-& )"NMdN R:K3 %<]@( j59%)N.G 9g92"58q#?p-e&wL \= 1'Jl*`5BG`*o*REEJ!SI.+'9*d c"+D~+ <#/,"2:*p>h3yJe%3,Sd ]:l  ' B|} Pt,Quyu!0" 5H 2 C s? %4,-'$RUVY7[ "@Z N) OqM "\\ %1] 0A84 v!^ . >(%/n7Y"VbOS&} 'LMj<WX RTV,D%RG2"gDQIR\,c$ ^"H=?KD,"[&"l,T 5$K" 3(zm!+|EAJF@8k$(z0E93!5C3J l 0>~ ; )FF)%V k5#5 NH*I/<  U-PI!q4~[3"L|q5 1#&&8;4qB!G4F-T9rB??kD( 9ADP=H37; E)5#~A6&@UP5F:zO0/XX3FQ0*=8=T M%G% #%iGGM& 64C"$6S i9/69Sx:o@}6' 547 :+(*E"T H..I 3sO?A,uFjB!(*1BA#N8 y8>@8 /@)S5>"9R=wBI10)TEIC 4>1H S?Uu;C1A}BR9LD"p<F~$>NEEL-'E 1M(14*T}Cg$0p&$+)B;2:NL]^h"Ifc>%C?%F4A NG1"3*=B"f&^$)7ET@J22 O_L=#Abu.S`5DC>kA@11\ F?0T~ G1`Pg&0CKOq)y-4<y<b MePoRi_?MNeH+LN*BR @F7Eg-s&M6 %3G1 /K?^K/N=}H27K~D)8L6H?4=/4A2S$X?; 6,2%TPw,Q<#| !`)\5o$]D=2#D)*3 !,G%d('Q,w 040C*B"mG?K #;0D {YS.1D=%q%Jo)N:7?ONR $!.R5'=J(.>!oMG0$N ?>n>F55;J#V)4 @M4x"61MM G>>>>G)LJ+)6)G>=1("L-2.2S !2BW7-],`QFI3;4">aIQ /u]F20'RyQ H/+) = J=P *oHtD!HmDn9Y d! p E~CIIKBEe 3^*5KF!H[Z$ ]P&.{HG4_;3?j j)QG" XZ< _!vJiQS1k -"G#-1 M$FH#28W-f> =&LSLV*@U6HJTLxH * ?1WR66w !0$AEi?FB"cKKy!;8s+@ }>25DR%/Np=oAQFP`G!@D'T$/hz ((.2*x,>:=(VQ P! qQ2tf G;BO2z@S 377@'1"fn:52 u85<,L6< I"SN23,"MJ0H<;<$ q t52F,$gBF W6$"e(nGC;E51' YEDL-BMb*V3.G2*'+ -OY< <|G~EN=  V/ nDAHi!OGFS@0A &kNU9k,)H ./2.WBM% _@%R.kMR%N ]SG,D=v?3S)P-MV>!CI^,"8ERP+2'#Tb5]7H)SS 5pC8 C-bQPyC&++!"G2,&v/GLOG'88u4:ZC7 D5*," =,E-}L0j-Q$`S0>CFAPGlAATG~L:%ST1*CSY(o#(+ 1F'D91$AA-<]=-4n+D2>Eg?#JiR^-W)I#JG %+C/P H,-6~M>M?i6*2 ^6z3%A|2x +vIXR+K FA? Q!4=D+?>&w*f5T:I0v@G?< oEN>ST~HM5M6'*/)*#3PMB5&,#K;-<5/<$Y-:04J/M.F*=I!K-W;SO$SP b6)0ovA+3.?O+:C;C,&%Z[ tQEAIRB3#5G*o CNJ,X9i;2.&FD-gOJ-8.)=  L0546-"6HTIJSRU8jI= 9 J5CO S8k+d"NwM4P:1.382.G.QL"3.x 384.Y8U@D"U!_JI3 )07S"9SF9# R)*97?,&ZC[CV#?&,*???mH&#CR>tBnd=8PD-AA*E(0D=D)$D & RD-x?k2w1 U UBHT )_F0w%=x4 ?0"y40=4' 0+>`F4")~( 4bI,8@i+P%r@IL~&qHoD\G5A-S%LC5 .8 q>oBJL[$!RC+5 ;&N #+J#K#TF;X)Y)G'[QJ}&Q8@ 0kTw"ZJS3OL*HS4+H=IQ>9S!)G*,+=ALKT#"[G\G?@LTI`;!{31~>A@}<5sf'A3X2K. 86:TT&! 2j>>(OO42g T >B0M/'C%~38Gp$O&&T) HH OPJgFI-III .cCD"\~T?5 'LNJ#6%d''wK)B4 K#oGO- 57 W /).uGvGG#wG" % &@"11^48Q*PkI;5/wN$-(.Q T _,g,II0#2 '69:C3P8K5 K0Ph? D71,QE@J0/IQ=QCr>z"*-L] #:93M+:C@@'B:Q3*( K (5J >g:D+ wA;U""2'&f((KC=KC%=F0A-Bb; GN(I=6>G9"APGL8OQ XBQ jR#D5@9;A@AQ}0!= Q~ S H*(C4$575I9AiK+@AuxBy? Lx1v <>l2LE?B!U I+`/a"?-=[ LVa>LyBK;F vF/9AaP'^3E=|2A) J# A %O$ J%S-A  *% U1I"=Z)A!-.O|M& M4. :;5N%.: K)7>)R283{uQ+( h1c1 24/74e &04# KK`BaBn 7<Q#;!Dqjq$$G#Bm LK (++(1Y,#* R. PHDR""K'+  $j4F{5) |8P&+-D+<!sSBM|zlNQ #O21MGBOBB49<=c*7lIIG74$H6NPWLo">8/>yA 50m2alLAQQ }G"/@M3M8QFNz?f-001O&NQ-1HPXOH-HR /?*z4 AOD/,n2>eC\ w#2=2*. > qDUQy#tuo.Pt,&YO( &@ G&CL>7= *76"*p./b76sD5u>12O:H ~?}THO(:>2@?37+*b A MlT=e>K6TAW1 6L)32G19H2H'GQh&-GQG=T/".97,*6/. QaG&-A80?6-A9oTPF<,HGTE"J=##v {>& DDz2: yH? @pTK3535 ;;5/!H QQ.#k4\C+j o7;~O /%<QJ?B@2r=P.4OpA 8!56;} N v 2:*&  (?(sTO2yT2~HRU2>0a$7CV6N?J=C H-A -'"Q5cVDh.HB,ij1P9&4ZEI7S`J/&8%`DaD[F}11 OO{L$g@{8{L%Z>J24OSSS3&S Rnw/L,1/'.BPI7;Rrg0sO"w;LiD=;SEH8++>s dAY|8F+3KG1Oe8] #H=F0P9'h,9E{T-9@Tn'"=8F#"Q>CEI!CF#RA8bPcPI?=STR7-A1 QJ?&?AD7F}IdN*E+HK9H@3|* -/Hy H;81}!t@ 2G%*ND, -PY0F: &TED]8LPaJCEv7GI96 +% "H(6')1)S7[1 KRT?8>Y$r$'09=5q n%:4 J662mL(AF%T5>T-* IUI[7?.*QBM RBt 9KDS. :MO*@I-FDbH$'X1@1! ;M40L(/oSaFz>NOL&(MQ5"?.L=D("C::3K i#St9@q %BX7k /9L.@JO!]^)lPgS$V${  %iE3:>O$;$(`&+.(+ %;!\(PeO9),]H=/%S675 @9GnFGFxQT% ;19Y:#P7 B NJ,|A5 ''03C6O$?N,:8 <+,;!=<J.0?A.o69>GOQ4h5/2q'$PcB86T6;Y 9'=-Jw7T2F / TbJ>1R n;0 .S^9 2 I|:7%J<<+1>"\2-<.GIgeKy.3G1+OP X#0 +KR_2$$6(%V )+.(RTM%#S:& 3Rl(qG%R :l.ZM'#lCjL 2Dw'FKK$L~KCl.M$N :8T) 54aM)%X 2) !!xG%$ $R$g%T4-hMz'7u92E 2!I BE(#9$"9:^EE 3!"!9 JLD I6Ad< .O=vE/dB^DEB0& cJL ~wx^ s2$ 7F 7ERc;d;%OL%eWPa,b,H8E &2N4 ;3JY>H PON@ P= 7J;#] = K& S3 J+7"E3zHFu<5:.QHI7D*m0M*N*0&E6,)?F15SC O4.j/# ]p6~*698?;6(,#%:>5O6O+( 1Hq-)82A3G^LH:NQ :$-m/O+MA t? >**;4012#A$A>9QQ72KLs6*!Q50#R(/ M.EE'N~GU K P.*e+v )/Q/|SyN'Ox*|N>z%Q+[IIe=N:"IB)RZ<ORKZ/  ; : wF~8 V JaRHN @):)E6QKHA!)?=,$3IS+409DD;"`3W 0PEQ,,+A{4Ie8/&G43@%6* L`JK$7T%;& J!>j$Jx C; y/Ch8t#0F)-d>RD>>%::$ :/N$@Ew9 PJ"?>[@ 8X&;b3 JkR/Y1& ( $P0= M-(n+rJ'[)4M-S}M#32QJ#?xM@6yM"86170A{M6.U4=@=?,6GhY+S*KGB8*N -~] ?&2 2*o=. @l'EJK8EP]8K$ >V4h<'M'-4L4cSu&1C S*_K#%(@B`K0;M%H*S < K?+6`O8k))?NA@2O8g7NJ;;8_!/ @+B*Q(KvH;!wJJ: WD&MvEXQi"s87x+(KK *3LF) ]B@(' vQ2& >.69:1&@77 [$ 2COu7B(H.L'8 ODDMY9hFe'*TKI&IP*O UJj;?0 ;3Se./ 7@ ;: > 7R&^+89+I.pKqK +1TA%a+7&< KR2$ $9-q?7)FqCH HlM$CC;JSODO N1*RAT.@1I/!/!A/,&&D'( BPR"-P6DD'SL/;DH>7@cRE*5`EaETCJ.AeRtH49?">{FN!B6FQ0G/M !l e&&N 41=S>S$f7EZ 5A9F" DApSM!bDA(G 'O#>A OACp fA 046A4EJM>0?877r-?x !#FRB,D&E!KRJ@>7A..3G*y@tO 46Z4e;1H&HNN"-H9w&P<5 2 DBANA;N,7 4Hz+&hKqA G2] (/(/J;CJ> XT IQ}@'Z.5[#[ HOBBDJ_Dl  IFGF3X! S?8Rn:EM&7SF*$*T8*8"F2%1513B%&.k0J,B #@5 0dSz!GJjmS"NR,/ \I E ?7'/-HCLxFD YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZ Z Z Z Z ZZZZZZZZZZZZZZZZZZZ Z!Z"Z#Z$Z%Z&Z'Z(Z)Z*Z+Z,Z-Z.Z/Z0Z1Z2Z3Z4Z5Z6Z7Z8Z9Z:Z;ZZ "%HFHDv~]BJJKLMNmpXZ\^`bdfrshj|SRGOPCABKEOPLN?Z@ZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZ[Z\Z]Z^Z_Z`ZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyZzZ{Z|Z}Z~ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZY`gnu|\\\\\\X_fmt{W^elszV]dkry\\'I<6|:ZA'H18\\Zahov}\\ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ Dy $&TU\cjqx(+~-/  023459   <>@EZ[[[[[[[[[ [ [ [ [ [[[[[[[[[[[[[[[[[[[ [!["[#[$[%[&['[([)[*[+[,[-[.[/[0[1[2[3[4[5[6[7[8[9[:[;[<[=[>[?[@[A[B[C[D[E[F[G[H[I[J[K[L[M[N[O[P[Q[R[S[T[U[V[W[X[Y[Z[[[\[][^[   "$&(*,\\\\\\\\\\\_[`[a[b[c[d[e[f[g[h[i[j[k[l[m[n[o[p[q[r[s[t[u[v[w[x[y[z[{[|[}[~[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[   !#%')+\\\\\\\\[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[\\\\\\\\\ \ \ \ \ \\\\\\\\\\\\\\\\\\ "$&(*,.02468:<>@\\\\\\\\!#%')+-/13579;=?A\\\\\\\nqY[]_aceg\\ik=A\RW\\\\\\\\\\ \!\"\#\$\%\&\'\(\)\*\+\,\-\.\/\0\1\2\3\4\5\6\7\8\9\:\;\<\=\>\?\@\A\B\C\D\E\F\G\H\I\J\K\L\M\N\O\P\Q\R\S\T\U\V\W\X\Y\Z\[\\\]\^\_\`\a\b\c\d\e\f\g\h\i\j\k\l\m\n\o\p\q\r\s\t\u\v\w\x\y\z\{\|\}\~\BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~\\\\\\\\\\\\\\\CEGIKMOQSUWY[]_acegikmoqsuwy{}\\\\\\\\\\\\\G:IIQ{   )*+,-./3579;=?><:8640@12QzMtu\\\\\\\\\\\\\\\\\-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQ\\\\\\\\\\\\\\\\\\\\\[bipw~%Q)FC\R\\\\] ]]w]]STUV678!#*', ;?lox}1.]]]]]]]]] ] ] ] ] ]]]]]]]]]]]]]   !"#$%&'(]]]]]] ]!]"]#]$]%]&]'](]}"OC>PFc7;>e$7*ABQQG,7G/.Dj1T K#2L#G~TQQF&,OT@M5 >G{DR LH;,(,:)M 3M82*JP*,al Om&E6>HB:D95- "dCeC:.UUUUUUU U!U"U#U$U%U&U'U(U)U*U+U,U-U.U/U0U1U2U3U4U5U6U7U8U9U:U;UU?U@UAUBUCUDUEUFUGUHUIUJUKULUMUNUOUPUQURUSUTUUUVUWUXUYUZU[U\U]U^U_U`UaUbUcUdUeUfUgUhUiUjUkUlUmUnUoUpUqUrUsUtUuUvUx. +&J-<9i(;CA+m5P-)nC1!+S](:94$RUC oL1pL WfAG*M HN E 02I0(F 7y7 e58*8;T'P2%0BfR(GzE'HE;3JFCBLy Ez/$| K@ =nAwUxUyUzU{U|U}U~UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUULA N!*#>C L,FVGCF}E'AK'%;?0O7+M#+8@= a b()2S3f-L*| F=E 6+K@`6D/ NS E&4F'85;H@tAP jK)<'%B$=2 8P9UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVV V V V V VVVVVVVVVVVVVVVVVVV V!V"V#V$V%V&V'V(V)V*V+V,V-V.V/V0V1V2V\#V?V@VAVBVCVDVEVFVGVHVIVJVKVLVMVNVOVPVQVRVSVTVUVVVWVXVYVZV[V\V]V^V_V`VaVbVcVdVeVfVgVhViVjVkVlVmVnVoVpVqVrVsVtVuVvVwVxVyVzV{V|V}V~VVVVVVVVVVVVVVVVVVVfIr  ' +S0R' )K28CA(|.=S!'}Au @;KGl=.3/8j6:=8(nO0&5*;',+Nh=,$?'$' VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVB0]Y 9Q-+RBE yF1Bw |TTFHQTQg7-<>::@J<[ *w Dh><* D6;1iy9+JYP)&=` +!G> q8HRQ4M3H| >@"J!BEJP |.$Pu8F WJT: 7I(J(3O&23VVVVVVVVVVVVVVVVVWWWWWWWWW W W W W WWWWWWWWWWWWWWWWWWW W!W"W#W$W%W&W'W(W)W*W+W,W-W.W/W0W1W2W3W4W5W6W7W8W9W:W;WW?W@WAWBWCWDWEWFWGWHWIWJWKWLW's$DC > K EC?q.SM!@K$%9v ''* SHMQ*% #a:FKKK'<):);)7JKT3mNm*. ?'j,/GP 2kDD Ot HD I E%v03Y/W445cO7!8!RgOhOO1SKTS\]Y[Zdlrq{} "%&#4<EB.FQJHWZX`Yfgkyvzswx.P?aLgX4 (O %E /c(EyR %?1Mi=DB}+,09,N.r*{C59 HQH08 P"i8*k, SP69-@T4 U+'%>cg-#,DFP(Hq,VRl,*&3Q *CAu#7=k?%I9 4&Q= +'(;FEMTU]dkeqz}  !67,EFH>ON^v%#f; ;0(KRL)B4E1N *F=E[A-+@l" _ 4,^!O&PXJ\",-: 2( )`.:B*1^8&W ^IE,_IPP* 6B.FH++0+$"F+ p(+(*nB5'TCIB-4e-NAQ&BQL"/-% L/A'-TJQ` &>QJSQ5S_.\4O":l#3=|>!Gg)(US6Qo#$!(#)/1B:6JNOehlunsmv1-;/JBIFKdXUas{p,+/.;/ 'T(ME)F)?IB' B.IIRUTE G& T=MEQb5k; 6!*R (:NK@)4#YJm3$D+1S>>T )s;i.7i5.UM0+>@ ")m7SF%Y G[L+8OHf$HE?R1APK HD g"g SEBHUZQPWaeuhkt{  *5',&)<H?]c`dghq{zr|<1( :SAM?"G4HH=- w= &BA"Q 3P"" &N` N34O(r3 8z:2 \18.+4SB'']:ix,J9t40!%HS& `?!$/! 2*R|?:;3F~SMr!0I\j7BR,ac3 , |/L'%70XWd_`\chYk}t{rvswux!$.-('&<=QCFNDR]dckx.) 9i*;94 ,)4* JH|#;-60wYR#~ >%F$B /E>BQ ;;SU=s"8N.CD1#T.;dLHPQJ7R(&Q!CdOnV2R!o TSF;`C0E8M} )8AiC:xE*'$&54B?AFibVmUYXWw|} #8?UFCOBEJnyrw; (Svk3&4+2p8@N<N 6Q .2FD 6/S O7)S2'2 =G7^ 0t0VM>"OP7I"m"0NSC(-;_ ;$R&%DF+Q7 &@ o,># ;u$-D(a9N1.1!0  ((pG 60S0`2&b9-)+86_^DA]CK?<ios "!.0(<=?_g[PLN$@#L NPR4%& TG%8)KNSmM#8ZP,8.- P?2OA-7! 6];J^PV+<f r,R ;j)>&dS^`$ 4C8Y%N(( 1lO  ,76=<LJIMecbdot(9K>vOUkhfiXdWY`](5B%;26<)+TQ%%D.8wE[hS<6mL,66.n b&"X9,C>.%U6.=3$K:QDL_RFM]]L}?5@H4,SW>V.9 /P.7aQ00N5J y ~N(Q_1 eNB*D48S4 K#)1rypvxwYD<@I;dn|w}+JFC,"GP#M'S7GH+?P  82R,CT4s,9T"05xDpR _ " <|D"4)GFVC3*>5=J$D D>V:Cm  @P) [49F>D|3uE=EDoB9=R;"p#7SQ^G.3('6>1&|stvr!' C87;G5}WS \lwabE5VT^ |%)^& 571S1?2C}9@-+DH&YTAJ#='8$52<!,96#E^QP|vbk{sl`   : > = < { V m Q Z o w b P l _ e ! ! )!3!.!'!(!G!RiN  BMuTE8?"7nKZJS-/R 5:lNBn 5<ANPeS6N'.'D'3''''''''''''''''''''f Fk ZT?6 i0&4&/O3 F {$8;9[6=/' 4Ng h)#O3(Y$KmI32N+ ceQfQPO Q1LW?=!G=78&:L@E0 DE=H " & &@8#&& 8:=?#.{QA =.V3k=='(((((!(<(B(F(D(S(Q(_(R(W((}(~((((L((((((((((()(( )))))))()#)$)")()=)>)A)B)K)S)N)M)P)Q)i)t)|)p)u)x)y)z)))))))))))))))))))))))) *****(AP:;JPI<4$"}9 5C6M3Ba/*/LT5@10AA&"84j=(TCQ-/BT(C,}4!? H+/ QE,CTM ={ *tDuD)vD'.@@dEu2L%&h7>* l8j< cEE> >V-,0$Pa;Fi&:U*+*3*/**)*A*I*Q*X*K*L*h*a*p*q*x**s**********************+ +*++&+%+X+8+@+;+1+4+/+M+l+h+g+|+m+q+++++++++++++++++++++,, , ,,,/,,$,,6,9,=,^)P04l d l-,5m8  0A*a6Ma w).p[-9eNGR6>M@W2Z?z9<;S9J&0D).(./% >S(K(oF<>-& a D<yQ $ICU;l/SQ "h. ! #1&>1 Fb-ANC,R,D,E,K,H,U,X,[,p,,,d,z,y,f,,,,,,,,,,,,,,,,,,,,,e-,,,,-,, - ----0-@-T-R-]-_-i-k-,s-t-z---~-{-------7G------------.- . .-)./...6.+.CjEE`##?Go( N)4N5)-N;2A@&=I +.@PQfE;wC405LEI E86- [TB,>[J4( pFH 2(Il1-.E.K.O.U.R.^.].Z.n.}.............................../// /////'/1/3/>/B/C/G/F/K/N/U/W/_/c/i/m/k/g/{/t/s///////////////////////00(t( :0GG$==/I1+L9T^?;Q>+@1@5R-  n*5lJ*LIS3+0X |%KIS-sEHBX{OS-*8l@ SQ -aF%5kj L{:T&JAYI D-{LSVC*QR 000/'0-0>050C0K0H0F0]0e0c0o0x0000000000000000000000000011 11"1 1$1210111513191F1E1\1^1P1V1K1G1O1f1M1J1{11|1~1111t111s1111111112111111282R > ( 3" 0$9_S |L4@ %5J~JNE; m KAASo,bST>I4;n /*=E*B /!SG H h? LW.7C@g-,>u-B* f4]T#(s@-M#!1N[\) i O*%3 3H<$3;$2%2>202<2C2*232N2+2I2w22u2v2p222222222222222223 3 33"33333;3L3J3F3B3?3D3R3U3W3Z3\3v3u3t333333333333333333333343444P4=464E4?44m44n44w4u44:y3?`R'N"4!C?LL@&F(-@ D,aK}#~#y+TUT6YBI45)/klGi>S3Z+78RAD@(?HG;4P8#QT4444445454444555%5$5'5(57595/5-5L5N5Z5^5a5d5p5v5w5u5z555555555555555555555555555566 6!6(6=61656%6E6D6B6G6R6Z6X6m6x6w66666666666666fH~M*N9MSg5UF/#E@5L:J8 8NP.6%&5M%E A E>'2T0 M *M /#1,R& 0$4 @>>M:J) (P$66666666676677/7(7#7'7$7%7>7C7H7N7R7d77Z7T7X7r7_7}7~77777777777777777777777777777777 888 8888188!88838-8$8G8N8O8V8f8c8o8j8z8w888v882*eGa'Y9-(87.F[x >8LF\+,(5R0{+ -} Js7Jy 37j"2)O&%W@28+.n6$L-3 B)=NL(5$=!06N9#+:GE RAjl:!DB'jN7;f'GMB:f.FmN?M8888888888888888888888999 9 999999/99+9S999!9,9F9W9299 9D9&999*9(9$9%9j9k9o9m9q9v9u9r9|9t9999999999999999999999R9999999999DB C?+$@82&!M R=m453@'.hrN%9R999999999:::::%:#:&:/:(:):1:::7:6:U:h:e:P:L:J:I:x::~::{::::y::::::::::::?::::;;;;;;;;;7;<;=;@;O;P;N;X;g;Z;r;b;h;\;};;;;;;;;;;;;;;;w%'!F3#:?Aq6r61k(:>@*uN0LF."F/4:Zn5zJmC\M5 5&6&J2EK'\>5 Nu'H*g#$3 %*$$a[Q@#n?%5$s)g#(6=$58DJ8)*R:D E /E(u gGOO"B9;;;;;;;;<<< < <<<<#< <(===[=^=q=c=m=f==============@4 8 [P7^L!,TC*B A2@MM0!1$>1M H31TR,?EFtW5P/- 0( h %rO<0Q.CO=]K L=*&;I3C% J0q7yI?u,e3 4$E\4o>D 0S-FPj^CH$M7Lye M======>> >->=>>'>>(>B>A>C>@>H>K>R>Q>]>^>`>b>o>s>x>v>y>>>>>>>>>>>>>>>>>>??? ?,?(?3?5?A?>?I?B???P?V?^?b?n?e?j?{??r??w?????????????????????: 16MS!b:a)%AeAYAjA[AuA]AgA^AAAAAAAAAAAAAAAABAAA:1=7(@R~ 40Lb5(3J@'D"*qPP)' /% *(D,Tq:,4<|Q/ 4&jBBSv$ !!JK-.D, Fr: b%7I] 2 C83}Kp%8O#FR(OfDG*D16S$#,%AAAABAAAAAAAFB8B6B4B:BWBVBSBuBBsBzBBBBBBBBBBBBBBBCBBCB$C#C/C-C C'C"C6CPCQCuCCrCCCCzCCxCvCCCCCCCCCCCCCCCCCCCCC D DDCOD+DDCC(7C@ @ StL]I/^.RH IRREQwDU5FQ,!nV5?'HU7i cFPqI.QQX5J>,(AF_P~4?DIDQDJDTDSDPDcDbDdDeDDhDrDDjDyDlDzDDDDDDDDDDDDDDDDDDEE EEEE E E(E#E"E!E5E9E7E:E8EGEFEREIEMEUEVE[E]EbEtEE~ExE|E{EEEEEEEEEEEEEEEEEEEEEFF*F+F'FM2+G C "57t,m*6RQJf!.E7N#-9Tm#Z% 88P'1JkfS$:O5W%ExR#G2S/7 PN;.f5M-Q6-3Ki" &'%85F9F@F?FVFWF^FZFmFtFFFFFFFFFFFFFFFFFFFFFFFFFFFGG G G-G$G/G'G,GUGEGRG_GJGCGHGfGZGMGLGGGGGGGGGGGGGGGGGG HHH HHHHHH$HHEH>HFHCHXH\HjHhHaHH )^JDC@z7PUS ? NACF5 *#%Ou;j.|3& 9W<#SQ;9[?c9bDN #(NBC$xP! O N8 J$ GAOin$:GR Y0v*o+p++<9:wP u+=&HQ9!@BHlHHvH{HpHHHHHHHHHHHHHHHHHHHHH&I8I-I9I7I0I+I,IIRI|ItIOIpIIVIYIaIIIIIIIIIIIIIIIIhJJ/JII0J(JAJIIJ)JIIJIIgJJIJJJJJJJJJJJJJJJ7?B=L$3?/ 0,tKS4O i~)4"@!4)"$a87G=B44 Q; f IT4K9_4E-D(fOE7RjF" $BI(!.BG2BIG;C4D4F6FJ3GKK/KK=KK+KYKZK[KXKiKTKvKVKKKKKKKKKKKKKKKKKKKKKKKKKKKLLKLL+L'L&L>L@LSLLL=L?LYL`LeLrLLLLLjLvLLuLLbLLLgLLLLLLLLLLMLLL!MMMM%M MLL,MdH:X8JD =Dh-r LQSEE 8XG6SEJJ; 98EPS-QH4TOW'JZHF- /R!Jn HO?zI4EP0XE4; Th 3UL<"G3}39L[D C7AAv:b~~3:P4:3 : "4" >Dl;??C  ;FJ,J/0S` Sj19O@18$FNG< {;C^2 &t.KIxOT{J|J7|5|.2,;&}RIK]MwP&FN$b8@%IKyPG @ H}5K $ D".NJ OH>5KEWEdRU8ERS SS-S2S3S5S8SESQSPSRSaS\SeS[SrSjSlSwSxSuSS}SSSSSSSSSSSSSSSSSSSSSS1TS T2T!T8T?T7TcTNT^TFTHTjTzTTTTTTTTTTTTTTTTTTTTTTUU UUUUU)]*]+],]-]B2fBqEBB&: (1[% r9CR RHH #>JJ, *"v BR\TBB@5`TXsJ0,/=,RLv,:+""%-L]>J*BiJ E<$!PM<Jv?0< OQ A-6/ <-xL0|>_HkH4Q9DK#2MM?-{?AL"!RI=e[., G%A4O%L0K:26.S9)@@=F"c fGxD?kT"(<._ ARH/>F: >>742TNN AF{#1>#::P>Gu*D')1lK)$&NC?K!ICN9GGSF (NMqRNA,>B B5 s ( *4T'=4o 733/NZ=:N/A! MK17?"JBX'*y" 2S :b+AR!,AGT7.R d-{;;Ps4WI"$_&8@4'QE@3m"ATS5@LT8^;s 8|FHMFgSZ0@, ;B9r+iP .D ,9 3++U1AY@. .b)($?5Tl3k1D ]T/QLT KO ?2O+='N (&o< 1;kB%#$}Q2~Q/aT&N->2 C pOx-!ME F5i7"9>t  ,1T*]6"{2GS@/>6 v"J$M*K]&0 D%0J-22v?JE1CGG)Nu%X /Qt6tC 3A2y1\72RW"Ie,0'5,c53 8'-Kf*UK3+72gI~5 ? >ER=!35;E4_F ,1w u)WK4"KY' P"JH/*ghQ/S6=RQ|H!#J3M90"& "4(|!5rRNQ7x&8M7LI5kP?l3uR-b'nPOz&T7? !I/2-05c).a&f665HBC< 2 "LG9TM@POL@!tPBq2);^R!y8@/L* L%w>B!D; L%D?;$K 11A: -Z1:9=L.>` .GT ?\KcM25C?x! 2.#ZB.=&(. FSP8P6{, /@|%>:]$fK+M;*^B-&? 'M(/ IS@qFvP0Od$Yv'7!IS(^MmJ$/%%v(*' gRZ&@ T@# XFDG IJ`.b.P )I58I6rZLII1VO?>S m 'RL -S i S< ?4FxML-iIc&FHLJ4^mI4k"E&F!l6T+1yDF?\J@:~<76FfCf3%43.G+I"% IANO/K&l9*>Y [5`{NIm)H!=Hc,\ 1&y2 ^OG3L F #M9 $ =:O.6)'KrQVPA%;I#@ fLmRM H= M. Q;G, =8PLbN @-H F;q. M;)PT9g ";Pz-(3 5X28FAMI&\9)O<94%M%L)e%=1V7hL$6?!DK8M Y R?"G8r"jPDN(TO 106EST8-I< ?9gM _" $UOR`HVI r%c3JzN_!B'P,.W>-KM:"Q8 &`IC )[^E2I."r+,+O\.,) h$EA[O;NAU"O.+&KS0P<} B7|&E5BV.I$NG (^DA8$eB4:DS13hRT0#-LC! K36I*6$9L\N#CC:{<%,AF6 TTI3AC3N3Kz*' &:S3*3EFCO@.Q*&8 +I"+"2&NKWGNzK[ =4$%9'  -% #>K)#:J\ ?$("@j3;".] ;Wv-p<:> ~/${0b1&KZ:v+/ &1( (.3M(" }!BI6/36--?-O)/'FLL3LM?Qu/< O-BN%LGTU*0 PM_=20 N TL K&1T@($:GA.G2R49/HJDw 0EMJ2,D L*J}265 X.6MNI3/mJ4!$J3R[B5N9+l!\' -/-M:UaLP9O9=s 5;4Ir)-7; 3+KC@x@*D-O} &DF}= ;JQ8t<>vB5LQ _ICL;:B,hE6SS3-(0`AoI/_EC*?LD'9KD bAQ.u aA! Z :.N. / UH U}- IZIG>%Gr!F~28;JF1P8 8.Sc N0.>2=Ok*O2>%N/H{,9Q,-.rX,P1EsI 58,J:!sR C2>},$<9ME5TQ7h _B2E5/=R,,"HC9CjE;!<$.0/6]+@IJ5"ZN:@2"e#IA=4a3?E ?  `N+#%S=3;2KT,3  '!+}=:9DG@T,!;(g#Q$MB@415s=65!iS/2:1:XwM,+Dd+z1@z?$9'V( H:6'e*)*1(%#/|6 w]%<&SPk>'T M9<e)!"g'/(.%2p/ +0@&FPJDRE\I(/F 9i:t775>#T//CFyS$VO";^#@p TQD.T >@?6>!P,=xO#6H BL>"8_@4P@o38I#.3K;_%p O&66)1SfDzK NoS+l f+HLk F.P2S2A&Y2 GcA O^I-Cc 2/^U%K4DC=H5#?(6 Y4BM;'C& D+v;#g>Q!Q$\B a.R+-cMI 5:FG_AL3O>xTI+c\p:#F~PP:RTmEH*.a2*A B&;!HIz.@6<;2D:q G/ u6:T;AqERFM&9*,)$TDJ.kL: ~R^7Y3G598&0]R%0C?)C;\1@owj~.M=AIA,900 %5G2|0$OB7-):.SQ N:|TI.;C9N0 %1"vSQA '7[ O/CH:XLR{u?"@'6yTI(?"2o p1p<$*Kl9K(E 'Nj9%B'B!:lPa2 (F/120'7EC A#u:'N-0z;8349Hq.Eno2VR+E%$jT"7/#F: !)t(JC" (w(p$PHCq3B $.$T 4&/)T9)N&.&!z#O)ce%) E$ .T;I' G2CPQ%K T;<5j'#  !&H+*)97*YGOl7m!!Wn664CD,B:vO`-O/B]'?6] Y,!7q#X$(=L7- NN4#'97r#;G@hGJM@4H@@J#@5v)k Y&<j / p8!-aOC&$0D #4m (MC IF*dKP;;DLj `@:5RD2e1 FH*B7-=19"hIQSP#Q42^<s9B(LQ4*0P*mA/q J0!_3;V=G)NNA< BJ65&>0S;:MbCK-$P JR((B%%LQJ3K2N NL M;e: NKZ!B'6%$-kFN,7,7,/4Nd H* ,} wOc'm1vRzOJ*S>h'4KAn'o'|JVt*, =69 (<140 B, UGJ"6N 1Y  :LMM A5MY6<S,nH2'we!Y(zg8RUP4DQf1{)G"6O0PW+>s) E/?-41GLPT@?0 )-+Y?9 K)F;H&HA** G'M?F>'*7hNBJFMo;hC!a L EBx%9:BQ|4U0+@Q P=1BSeBo5F#? -E9*B3O~B-A 2!-A RwKF&mP634:+O!QRpE+X">+) 8uMoIF;AT ,#k;F-y.M?|N/9 "/0'R $3[@#[8II!C0$=sU>#tn) > KNa\>>0#>TTr H#@0%G0$-%ULO I0(P&>D `7*b.yK;4pC0x('%.5>0KK$L?BOZ6><&OF7 es:c@8HH:!6w'KB'l0m0'opq&r7rE HO\:H'y8'<:?O>5"M ^ J;J SIU< =:P95=qH3>07= Q7 g<+6m$#<:"POX%r D)'l!E$3 U2.C "S#l/ 3<Ti3~!d:=:`H(2*, ,'GJZan< *{)KTMF !,1('#?1P 2SpJUn6RR8 Q*Tn,9(,D$!5 CNH 6$Bm-cW!);L BH]9]SCIr P@.qN<9@B:$AK!P7-q5HA0KpMP`W\(4 S:QeE&))%$M5C=sA+   *AH6KP'&RM%(c-'6{%7%L!I OX/ S)FKGsIQl$A 2C17RL@LcL4 #8JoG(6I/J7->>CN[0D)#MUs??/ F!SVQ/E56QN@sQM (L8 ?=J41402PM/R| 'S. /Nd'P;OH9??:')W0<R5<F4A87?RJ)wRs '0 :3?*j ,}`)KO'J #kJ304J:A3S"H=!LFz L*IS,5*/} P0"% )&x M= ^ 2)(#J }P2;6%/FE2! $+T: :$<.0(w.,*. Q'0.7#0<1uN$c>F>Z! E:(zS|R8X0a#<#bT#"11G6GHA_0 `022L2=4BdT#6t:#?g:d2 R'/60t2>4l*"0v6VCJ d%LY5O 4T' PL4mE-QX:4=#1-HW*r8RP7QA% ;231A7M;J0=5l?J$+~ 5*-H#!:L L1(b4[*3 *F*CJ"I?0RG((=C::9 PBH%u5JQEx3IT ; #:>@F@G@L%J4 9=3">U0LW;K/D@/L T,&:(3DN;="y(HH3!>3z$6Q#+kE[5k Z#M/gQ=\*I%54 #/1S7;T=%W=/:)MB <7/_9j0<BC9RP9^*//7"+&+@%4,K3B79RyL&@P-T40 8O:%:=M  h"YC]G4 Q6!J9?.7BD3Og3#S629?6 L"MDP6#/ %4 .;+(QeT0:#1!&P/)6** 7E&f2g22-#?.s5a-B;jMkMGnDffT'i7*11EQM>o1n&n01E GOL 5|.u?0Lj377j>,\8M0(@b(NO,!L^0I,BN T#RsLzL{ B-.1 e7I0R^(ROA7N@+p9 +w3-O]4472;k<BBT+'%=AS&T6N E6l4IP'A$S L0fJc+nQ11H 4 &TN%-|PxD +RrIj4/i' ?Ne40N!@ @#L0-E<O r8` ;9C& @NPRK&)?>IjJ`@|"bCN$Q!nEn?!0=+7O;3Ln-uP:UAg4z71=a%;7<7!+ 7%T"BKC8T13Co- 0= ?C5,QG8 >$]#e/)=Ef)s'T:%#+gTR-LN8E83=ER#hT% 59O??L 6O&G0414w:H6B2?e96%F@-LO00!4>7O"O{"uM!8()2"*?Gm&"D? CG=+18' ! y1?nTA YMI[!\!v#B]!1 l>=1="~AD8# $/(#09TS/h4b2 (C53 >FM1;% I{SP"c#81?vJwJ@T#cq1  !xJT]99q +6244=5=N_*U >GMWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWXXXXXXXXXM0d#*>KG A6 dJKMC@8 )4DV|= >PHLI.r R'K( :SLWA !JI)TfMPK(>MClFJD09)1B X X X X XXXXXXXXXXXXXXXXXXX X!X"X#X$X%X&X'X(X)X*X+X,X-X.X/X0X1X2X3X4X5X6X7X8X9X:X;XX?X@XAXBXCXDXEXFXGXHXIXJXKXLXMXNXOXPXQXRXSXTXUXVXWXXXYXZX[X\X]X^X_X`XaXbXcXdXeXfXIm+OLO#I^"~ JJP B>,2G*G N @GGGPP" MI*OG|(_,MJ 40 N?R\Q$+&? ( }+3TaWMWMs<<9!@A"?;R4889=7 BXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYYYYY Y Y Y Y YYYYYYYYYYYYYYYYYYY Y!Y"Y8 Gm>w:C$HAADE@kOr.;-1O'TekK FJD)Of9T GM =v'p' 5DJ.H TNL I-*O 4UNG.AJ T #GJ'9/:/G( (! }' c44b #!DN7$V&\%&#Y$Y%Y&Y'Y(Y)Y*Y+Y,Y-Y.Y/Y0Y1Y2Y3Y4Y5Y6Y7Y8Y9Y:Y;YY?Y@YAYBYCYDYEYFYGYHYIYJYKYLYMYNYOYPYQYRYSYTYUYVYWYXYYYZY[Y\Y]Y^Y_Y`YaYbYcYdYeYfYgYhYiYjYkYlYmYnYoYpYqYrYsYtYuYvYwYxYyYzY{Y|Y}Y~YYYA:M16G L%vk8}\DCE .]/]0]1]2]3]4]5]6]7]8]9]:];]<]=]>]?]@]A]B]C]D]E]F]G]H]I]J]K]L]M]N]O]P]Q]R]S]T]U]V]W]X]Y]Z][]\]]]^]_]`]a]b]c]d]e]f]g]h]i]j]k]l]m]n]o]p]q]r]s]t]u]v]w]x]y]z]{]|]}]YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY졧¡@AB¦æĦŦƦǦȦɦʦ˦̦ͦΦϦЦѦҦӦԦզ֦צئѧҧӧԧէ֧ا٧ڧۧܧݧާߧק\C